CAZyme Information: MGYG000003831_01426

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000003831_01426
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
631	MGYG000003831_38|CGC1	71610.32	7.7273

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003831	3246644	MAG	United States	North America

• Gene Location: Start: 6548; End: 8443 Strand: +

Full Sequence      

MKKSLTVSCVLALSVSAVSAQSLYPGMFADKIKVEAKTKSSVTPLPLRDVRLLEGRFKDN
MDRDARWISKVDVNRLLHSFYTNAGVHAGREGGYMTVKKYGGWESLDCELRGHTTGHLLS
ATALMFAATGDDKFKLKGDSIVNGLKRVQDTFGNGYVSAFPEELINRNIKGQSVWAPWYT
LHKILAGLIDQYLYADNSTALDIAVKFGDWIYNKLSPLDEETRKLMIRNEFGGINDALYS
LYAVTGNDRYRKMAEFFYHNDVIDPLKQKDGNMGTKHTNTFIPKTIAEIRRYELLGDEES
LNLTRFFWDEMMANHTFPTGSLSDKEHYFAPEDFSKHITGYTGETCCTYNMLKLARHLYC
LSPDAAIADYMETATYNHILGQQDPESGMVCYFLPLATGTHRVYSTPENSFWCCVGSGFE
NHAKYAENIYFKDDNSLYVNLFIASKADWKEKSMSLTQTSTFPHDNALSMRVSADKPVKT
SLKLRNPGWMKNGKVRINGKSVKAETKNGYFILDRKWRDGDRIEVTFDTELSVETAPDNK
TIGMVKYGPIVLAGRLGTEGMQSPAPFSDPSKYNDYYTYDFHIPSSLKEVGLNPSELKRT
GDLKWETPSGIKVEPFFDVHRERYVVYWKIK

Enzyme Prediction     

No EC number prediction in MGYG000003831_01426.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	49	553	1.1e-191	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	49	553	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	6.60e-115	34	557	1	505	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	1.50e-06	582	628	38	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.
cd04792	LanM-like	1.29e-04	184	265	597	689	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.
cd20171	M34_peptidase	0.006	98	163	65	124	Peptidase family M34 includes the C-terminal catalytic domain of anthrax lethal factor (ATLF), the protective antigen-binding domains of ATLF and edema factor, and Pro-Pro endopeptidase. Peptidase family M34 (also known as the anthrax lethal factor family) includes the C-terminal catalytic domain of anthrax lethal factor (ATLF, EC 3.4.24.83), and the N-terminal protective antigen-binding domains (PABDs) of ATLF and edema factor (EF). ATLF and EF are enzyme components of anthrax toxin and are carried into the cell by a third component, the protective antigen (PA). ATLF is a highly selective protease whose major substrates are mitogen-activated protein kinase kinases (MKKs). At its N-terminus, ATLF has a PABD domain which lacks the hallmark metalloprotease motif HEXXH, and, at its C-terminus, the related catalytic domain has the HEXXH motif where the two His residues bind a single zinc atom, and the Glu has a catalytic role. EF acts as a Ca2+- and calmodulin-dependent adenylyl cyclase that can cause edema when associated with PA. EF is comprised of the PABD and an adenylyl cyclase domain. This family also includes Pro-Pro endopeptidase (PPEP-1; EC 3.4.24.89, also known as Zmp1) which is an extracellular metalloprotease that shows a unique specificity for hydrolyzing a Pro-Pro bond and is involved in bacterial adhesion.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCA49451.1	5.38e-295	2	631	5	640
ALJ42763.1	1.54e-294	2	631	5	640
ALJ62034.1	2.18e-294	3	630	4	638
QUT42773.1	3.09e-294	2	631	5	640
QQA07126.1	4.08e-294	2	631	3	638

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	1.55e-111	35	629	18	649	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	7.67e-107	35	629	18	649	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	1.26e-24	131	551	88	543	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	2.35e-19	119	527	83	530	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	6.78e-18	119	527	83	530	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000342	0.998938	0.000191	0.000178	0.000166	0.000151

TMHMM  Annotations     

start	end
7	29