CAZyme Information: MGYG000003835_02507

Basic Information

• Species: UBA7173 sp001915385
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173; UBA7173 sp001915385
• CAZyme ID: MGYG000003835_02507
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
749	MGYG000003835_30|CGC1	82607.73	5.0726

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003835	3225656	MAG	United States	North America

• Gene Location: Start: 16000; End: 18249 Strand: +

Full Sequence      

MKLRKIVIPALMAAVAAGAGPLYKNSKAPIDARVEDLLSRMTLDEKVMQMQNFPVGKLDE
IADRFKENSYGSTHEMDHNAYDAAVIYKTLGEHLKKNNRFGIPIINCCEGIQGILQNGCT
LFPHAIAQASTWNTELIEEMTQACAREARAIGIRQVLSPVLDVARELRWGRVEETFGEDP
FMIAEMAKAFVNGYQSEGVLAMPKHFVAHGSPSGGLNCASVAGGPREFRSIYLYPFRRVI
AECKPGAIMSCYSAYDGEPTTGSRYYMTDLLRGELGHTGYVYSDWGSVERIKSFHNAVAT
PEEAARQAAYAGVDIDTDWTYQTLADAVRQGKLSEDVIDTAVRRVLRKKFELGLFEGDKI
NPDDVKKVVRSKEHVALAKRVADESIILTENKNNILPLDTDKYKKIAVVGPNGHYALMGD
YAWTNSEGEEGIDLYEGLTAALGDKATVTYTEGCDWWSQDDSRIPEAVKAVEDADVAVVA
VGTRSTFLGRGGNKNTAGEAYDLSSLELPGRQLDLIKAVKATGKPMIVVFITGKPLVMTY
VQENADAALVQFCGGEQQGAAMADVLLGNVNPSGKLTVSFPRSTGNTPCFYNHYLTDRDF
WDKPGTPADPKMRYIFDTPQPVWNFGHGLSYTTFEYSDLEVDNKEPKDTDTVTVKVKVTN
TGDREGKETVQLYVRDVVSSVSTPVQQLKGFKKINLKPGESEVVEIKLPMKELALWNTRM
EEVVEPGDFELQVGSASDDIRLKDVITVK

Enzyme Prediction     

No EC number prediction in MGYG000003835_02507.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	96	315	9.3e-67	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	7.38e-171	31	741	35	758	beta-glucosidase BglX.
COG1472	BglX	1.70e-90	41	424	1	372	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	2.99e-79	25	734	44	769	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	1.02e-68	42	347	1	315	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	3.73e-61	386	631	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALK83130.1	0.0	6	748	13	756
ABR38447.1	0.0	6	749	13	757
QQY38586.1	0.0	6	749	13	757
BCI61926.1	0.0	1	749	1	753
QQA08973.1	0.0	21	749	28	757

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	4.87e-162	21	741	5	749	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	3.83e-161	21	741	5	749	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	2.37e-123	23	741	36	778	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	1.76e-118	24	741	4	745	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	9.57e-118	24	741	4	745	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	4.96e-139	6	749	9	723	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	5.79e-119	23	741	29	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
Q56078	6.35e-116	18	743	25	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	3.67e-114	18	743	25	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
P14002	4.26e-100	93	748	28	668	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.430297	0.515320	0.053265	0.000480	0.000301	0.000316

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003835_02507.