CAZyme Information: MGYG000003838_00200

Basic Information

• Species: QAMM01 sp003150405
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; QAMM01; QAMM01 sp003150405
• CAZyme ID: MGYG000003838_00200
• CAZy Family: GH63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
604		69570.7	4.749

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003838	2498756	MAG	United States	North America

• Gene Location: Start: 215626; End: 217440 Strand: -

Full Sequence      

MTSYEALKHQYMNGWQTWNNASVLSHVMMPEGVGLALGLKDYKRAKLLDTALIGQTEEEG
IVTPYAHAYDNSFTEVKLDWLENSINVKTALDGDDLVLLVTPLKQPMKCSSLIINGISLW
NKGGTVEKEEEILLLKGRNKQIPVYMTAPHNGELFVRCTTPFLSADLSGAVGISTGRPRT
VEEIEAVIKRQQEKWAANKDKYGKLAEAYNAMQTCQAWDTIYNPQEDSPITTVSRIWNNQ
WGGYVLFCWDTYFAALMQSIDNKELAYCNAIAITRTITDAGFVPNYACQNNFKSFDRSQP
PVGSMVALMMYKKYGDKWFLEELYDDLITWNQWFIDHRSTKNGLLAWGSDPYDMVTGHDL
EKFGVHERLGAAYESGLDNSPMYDDIPFDEERNIIVLEDVGLVGMYIKDCYCLAEIAEIL
GHTEKATELKMRAETMEERMESLWDEDFGMYLNRREDTGEFEYRLSPFHFHALFSKKVGQ
KRARRIIDEHFYNEKEFWGEYIMPSIARNDPAYPEQTYWRGRIWAPMNFLAYMAICSYDC
PDARKDLAEKSEKLILKEWLEKGHVHENYDGDTGEGCNSPRSDKFYHWGGLLSFIALYEN
GYYQ

Enzyme Prediction     

No EC number prediction in MGYG000003838_00200.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	216	580	6.4e-27	0.38421052631578945

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03200	Glyco_hydro_63	3.16e-15	319	595	187	491	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
PRK10137	PRK10137	1.52e-14	279	575	389	762	alpha-glucosidase; Provisional
COG3408	GDB1	3.27e-09	244	599	282	605	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
COG1626	TreA	4.37e-05	246	488	172	443	Neutral trehalase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK58860.1	1.30e-209	1	602	15	617
QTH44429.1	9.95e-204	2	602	15	616
QNI32096.1	1.92e-184	7	599	1	600
QLE02613.1	5.17e-183	5	602	32	622
QRQ47302.1	1.09e-178	4	601	31	630

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	1.11e-09	232	580	305	740	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	4.40e-09	232	580	305	740	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	5.79e-09	232	580	305	740	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	3.99e-08	232	580	306	741	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	6.15e-09	232	580	328	763	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003838_00200.