CAZyme Information: MGYG000003838_00801

Basic Information

• Species: QAMM01 sp003150405
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; QAMM01; QAMM01 sp003150405
• CAZyme ID: MGYG000003838_00801
• CAZy Family: GH10
• CAZyme Description: Endo-1,4-beta-xylanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
327	MGYG000003838_3|CGC9	38061.22	4.9081

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003838	2498756	MAG	United States	North America

• Gene Location: Start: 200927; End: 201910 Strand: -

Full Sequence      

MSCSMKEIVGLKEKYRDYFKIGAAVNAASIVAHGDLLKRHFNSITAENATKPAVVCPEDG
SYHFEEADQIADFAVENGLALRGHTLVWHAQVPDWWFQGADRGVLFARLERHMRVMAERY
PQMYCWDVVNEAVEDHESYLLRKSRWLELCGEGYLDAAFHAAKRIFPEADLYYNDYSEFR
PDKCKKMIALVKGMLERGVPVDGVGLQCHWTQDQPTMDELRRGMEAYAELGLKIQVTEMD
LSVYDFDDRSVGTGKPDPQRMELQAKRYGEAFRVFREYREVMDCVTLWGVSDDMTWLDYF
PVERKNWPLLFDEQGQPKEAYWRIIDF

Enzyme Prediction     

EC	3.2.1.8	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	11	326	5.7e-102	0.9900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00331	Glyco_hydro_10	2.20e-116	11	326	1	310	Glycosyl hydrolase family 10.
smart00633	Glyco_10	1.47e-104	51	324	2	263	Glycosyl hydrolase family 10.
COG3693	XynA	4.57e-89	22	327	39	340	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADE08352.1	1.46e-120	6	326	3	334
QIL68818.1	2.39e-119	11	325	12	333
AZP05644.1	1.30e-118	11	327	3	326
AFE82288.1	3.82e-118	7	327	7	329
ACW01926.1	3.43e-113	8	327	10	336

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Q8X_A	3.24e-111	11	325	8	329	Thehigh-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from G. stearothermophilus [unidentified],2Q8X_B The high-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from G. stearothermophilus [unidentified],3MSD_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSD_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSG_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSG_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
1N82_A	4.59e-111	11	325	8	329	Thehigh-resolution crystal structure of IXT6, a thermophilic, intracellular xylanase from G. stearothermophilus [Geobacillus stearothermophilus],1N82_B The high-resolution crystal structure of IXT6, a thermophilic, intracellular xylanase from G. stearothermophilus [Geobacillus stearothermophilus],3MUA_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MUA_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
4L4O_A	1.47e-110	6	327	8	337	Thecrystal structure of CbXyn10B in native form [Caldicellulosiruptor bescii DSM 6725]
3MS8_A	2.63e-110	11	325	8	329	Enzyme-Substrateinteractions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MS8_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
3MUI_A	3.72e-110	11	325	8	329	Enzyme-Substrateinteractions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MUI_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23556	3.37e-108	9	327	15	342	Endo-1,4-beta-xylanase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynA PE=1 SV=1
O69231	1.59e-106	7	325	4	329	Endo-1,4-beta-xylanase B OS=Paenibacillus barcinonensis OX=198119 GN=xynB PE=1 SV=1
P45703	1.28e-102	8	326	5	329	Endo-1,4-beta-xylanase OS=Geobacillus stearothermophilus OX=1422 GN=xynA PE=1 SV=1
Q12603	1.57e-98	7	327	31	352	Beta-1,4-xylanase OS=Dictyoglomus thermophilum OX=14 GN=xynA PE=3 SV=1
P40942	1.24e-78	4	326	40	381	Thermostable celloxylanase OS=Thermoclostridium stercorarium OX=1510 GN=xynB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003838_00801.