CAZyme Information: MGYG000003838_01342

Basic Information

• Species: QAMM01 sp003150405
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; QAMM01; QAMM01 sp003150405
• CAZyme ID: MGYG000003838_01342
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
628	MGYG000003838_8|CGC1	73289.68	5.3985

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003838	2498756	MAG	United States	North America

• Gene Location: Start: 31583; End: 33469 Strand: +

Full Sequence      

MQTIQMKIDFSKNPIPFPHFFNAFGYAHCDYTYTKPSRKMYRHLASIGRDFYYMRLHSIL
TAHGDGDLYILTEGQDYGNPDVNAGRWVDKVFSMKDGKLACEWKYVDQIYDIILASGGRP
IVETHFIPSCIQSEDYFIPKDYNLWAEVLQLFVRHCIERYGLDEVRKWYFEIWNEPDNHE
KWLHDSSTLMAFYDYFEYAIHSVDDQLKVGGPAVKQWEGAEKIYREFLEHCAHGLNYKRG
TFGTRIDFVSVHCKAGYPEENNPNIDVMFEWLKRYTSILQEYPEFRDIEFFNDESDIVWH
GNLGTWVKSWLNFRNTHYPAGITCKMMTKYCDLVLDDWKVNLKVVDSDNCHTQWERYLYS
GNRSQFTPLNKYGTDDLIKKPLFNAYVLLNRLGDIRYKAVCNDEGFGDKFGVLPTSCKDG
YAVMVWNFEDGMEDDINPRKVHLKLDEMKSGRYRLAHYRIDKEHSSSYHIWQQFGKPEEP
NAEQIQAMRAHEGLELYEENMEMLLGSGCALDVELPMHAVSLLLFTPVSQTAPAAPEGIW
ATAEDGFAGNRQIFLQWKPNREYDLMRYRILRSEDGGDYKEITGNTMLNVSAYTDMTAER
GKTYRYIIKAQNFSGAESGASEPFTIEA

Enzyme Prediction     

No EC number prediction in MGYG000003838_01342.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	50	481	2.1e-66	0.9118329466357309

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	1.11e-42	38	492	40	455	Glycosyl hydrolases family 39.
COG3664	XynB	7.54e-13	91	528	27	427	Beta-xylosidase [Carbohydrate transport and metabolism].
COG3401	FN3	1.42e-04	525	627	154	251	Fibronectin type 3 domain [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQO10984.1	1.07e-196	6	621	6	632
QYN31969.1	5.62e-57	1	532	26	575
QHT66255.1	1.63e-54	1	523	28	562
QEC76346.1	1.09e-53	2	526	27	563
QBE65838.1	2.93e-53	3	526	32	564

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NDX_A	3.97e-34	97	618	69	614	Thebacterial orthologue of Human a-L-iduronidase does not need N-glycan post-translational modifications to be catalytically competent: Crystallography and QM/MM insights into Mucopolysaccharidosis I [Rhizobium leguminosarum bv. trifolii]
1PX8_A	3.05e-27	105	489	81	444	Crystalstructure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1PX8_B Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_A Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_B Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_C Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_D Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum]
2BS9_A	2.44e-26	105	489	81	445	Nativecrystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_B Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_C Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_D Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_E Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_F Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_G Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_H Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1W91_A	7.85e-26	105	489	81	445	crystalstructure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_B crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_C crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_D crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_E crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_F crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_G crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_H crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct]
4M29_A	1.37e-25	94	524	74	493	Structureof a GH39 Beta-xylosidase from Caulobacter crescentus [Caulobacter vibrioides CB15]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P36906	1.24e-26	105	489	81	444	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynB PE=1 SV=1
O30360	2.24e-26	105	489	81	444	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=xynB PE=3 SV=1
P48441	6.76e-26	99	625	97	627	Alpha-L-iduronidase OS=Mus musculus OX=10090 GN=Idua PE=1 SV=2
Q9ZFM2	1.90e-23	105	488	81	446	Beta-xylosidase OS=Geobacillus stearothermophilus OX=1422 GN=xynB PE=1 SV=1
Q01634	6.46e-22	99	605	106	618	Alpha-L-iduronidase OS=Canis lupus familiaris OX=9615 GN=IDUA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003838_01342.