CAZyme Information: MGYG000003840_01046

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UBA1740
• CAZyme ID: MGYG000003840_01046
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
425		48466.48	5.3437

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003840	1422591	MAG	United States	North America

• Gene Location: Start: 1677; End: 2954 Strand: -

Full Sequence      

MKPLPSAKQLQFLSWEFGIFFHFGIRTFYPGHRDWDGVEMPASGFCPTELSCEQWIRAAK
EAGATYAILTAKHHDGFALWPTAHSGYSVADSPFRGGRGDVVREFTEACRKYGLKTGLYY
SPAQWGSHAIPFANGEEYDTYFIQQLGELLTGYGKIDYLWFDGCGSEGHVYNRKRIVSEI
YRMQPEILTFCDPEWTPGVRWIGNEDGYASLENPLAVSETDFSELAAEKETLSNRIFLPG
ECDCKIRNTWFWDENEETLKSTEELFGMYEMSVGHGSNFLLNIGPDRRGLLPEADMARLH
ALGERIRTSYGNPLPYTAPERQGDCYTIRHREADSAEWAYPDPGRLSNCIAVEEDLADGA
SVTSFRVYGYLPTYKEKKILLFCGRTVGHRVYCRFSPIRCPRFEVEITGHEGAYRLRDIR
AYYVP

Enzyme Prediction     

No EC number prediction in MGYG000003840_01046.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	8	306	1.3e-74	0.8554913294797688

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	8.33e-57	3	422	9	430	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	1.61e-45	17	304	27	326	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	9.36e-40	17	304	28	328	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam14871	GHL6	0.006	53	115	3	61	Hypothetical glycosyl hydrolase 6. GHL6 is a family of hypothetical glycoside hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS95058.1	1.16e-134	2	423	4	415
BBH22425.1	6.84e-133	5	424	9	415
QHW31138.1	7.96e-129	4	423	18	429
QHT59657.1	1.33e-126	4	423	18	427
AZN39798.1	2.68e-123	4	423	8	417

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZRX_A	4.24e-71	4	423	31	459	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
3EYP_A	1.45e-67	4	422	9	454	Crystalstructure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],3EYP_B Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],4OUE_A Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OUE_B Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_A Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_B Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482]
3UES_A	1.57e-64	5	409	19	463	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3MO4_A	8.93e-64	5	409	21	465	Thecrystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3MO4_B The crystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3UET_A	1.78e-62	5	409	19	463	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UET_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	3.59e-61	3	314	36	348	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	6.97e-59	3	409	38	463	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
Q6AYS4	4.00e-16	2	309	36	355	Plasma alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca2 PE=2 SV=1
Q99LJ1	9.30e-16	2	307	33	349	Tissue alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca1 PE=1 SV=1
P49713	3.30e-15	2	306	28	342	Putative alpha-L-fucosidase OS=Caenorhabditis elegans OX=6239 GN=W03G11.3 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999633	0.000356	0.000020	0.000001	0.000001	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003840_01046.