CAZyme Information: MGYG000003842_01369

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Eubacterium_R
• CAZyme ID: MGYG000003842_01369
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
665	MGYG000003842_67|CGC1	73719.07	4.5107

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003842	1754576	MAG	United States	North America

• Gene Location: Start: 3255; End: 5252 Strand: -

Full Sequence      

MKFIKKISDAFHSRAGAYIFFLLSVFAFINLKGATWAYGWIAELYPLGDKFVPTLLGVIA
VTAAVHFIYLFFSAFKGEKKKDVKGITALNILHTVFAVIAVAVFIYTAVLVFSLDSGFTA
DKISNGFKAIISNLIYPALAGGMGLMLVFCSSSKKAVQALISGAVVSAVVIGCTAMPNIQ
SGNYDNKNLPEITLQSENVLDGAAISFESLKKDEKPDAINMLSNDNSCWTAQAPAGMPAD
GYPDANNSYAEIQLTQKSEFNTAIIEESGNEAQFFRLQAFINDEWVTVYQSEKIQAMRIC
SFDTVTTDKIRLSIDKFRSEDTPVKIKSLKLYNEPKRDMTDFEVTAYQRLDGDVPTEILA
KGEDYVNNYARFYDVYSTIIVFAAVHWDENGKMNFGESGEEKFASEVAALKEIIAHRSNQ
SHRVKLIVTALADGAWGDGHNGVNSYMADCWEDVANQIVDFTKKYDFDGVDIDWEYPASA
DDWKNYDSFIQKLDRNLSEYKEDFVISTALSAGQLGLSQETFNCIDQIQYMAYDGNDEDG
YQSSLHQAEEGLKAFADNGADISKINIGIAAYARPINSTPYWASWRALEEANYWNSKYYT
IHDGDQVYEGTFCSPALAGDKLALALFSGAGGVMVFRSCCDKTMNDPNSVACGLENTLHR
YAENW

Enzyme Prediction     

EC	3.2.1.14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	378	648	2.5e-31	0.8885135135135135

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00704	Glyco_hydro_18	3.69e-24	378	636	24	302	Glycosyl hydrolases family 18.
smart00636	Glyco_18	2.73e-21	367	574	10	238	Glyco_18 domain.
cd06548	GH18_chitinase	5.41e-18	455	641	114	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
cd00598	GH18_chitinase-like	4.33e-15	378	534	25	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
cd02872	GH18_chitolectin_chitotriosidase	1.49e-13	386	574	49	245	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACU59678.1	2.19e-12	418	643	79	288
AEE61812.1	2.63e-12	429	577	107	264
QNK64943.1	6.62e-12	408	577	77	241
BAA24795.1	8.27e-12	419	610	234	419
NP_001034515.1	8.54e-12	378	659	52	384

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3G6L_A	4.31e-10	455	646	134	371	Thecrystal structure of a chitinase CrChi1 from the nematophagous fungus Clonostachys rosea [Clonostachys rosea],3G6M_A crystal structure of a chitinase CrChi1 from the nematophagous fungus Clonostachys rosea in complex with a potent inhibitor caffeine [Clonostachys rosea]
6EPB_A	5.75e-09	431	660	126	396	Structureof Chitinase 42 from Trichoderma harzianum [Trichoderma harzianum]
3WL1_A	2.15e-08	431	574	84	256	Crystalstructure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with reaction products (GlcNAc)2,3 [Ostrinia furnacalis],3WQV_A Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with a(GlcN)5 [Ostrinia furnacalis],3WQW_A Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with a(GlcN)6 [Ostrinia furnacalis]
3W4R_A	2.96e-08	431	574	102	274	Crystalstructure of an insect chitinase from the Asian corn borer, Ostrinia furnacalis [Ostrinia furnacalis]
1GUV_A	3.40e-08	429	574	71	248	Structureof human chitotriosidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P32470	1.89e-09	372	646	71	388	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
P48827	2.24e-07	431	642	126	384	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1
P36362	3.72e-07	431	574	100	272	Endochitinase OS=Manduca sexta OX=7130 PE=2 SV=1
Q13231	4.31e-07	429	574	92	269	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
A6N6J0	9.22e-07	431	660	127	403	Endochitinase 46 OS=Trichoderma harzianum OX=5544 GN=chit46 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
19	41
51	73
92	114
129	151
158	180