CAZyme Information: MGYG000003843_00929

Basic Information

• Species: UMGS693 sp900544555
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-138; UMGS693; UMGS693 sp900544555
• CAZyme ID: MGYG000003843_00929
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
630	MGYG000003843_4|CGC1	71763.2	5.7507

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003843	2332331	MAG	United States	North America

• Gene Location: Start: 50830; End: 52722 Strand: +

Full Sequence      

MEYHLNETELYLFNTGENCYAYRVMGAHKVENGAYRFAVWAPNAKAVSVVGSFNGWNGDA
NPMRMAGTSGVWEAVVENAKKGDVYKFAVTSRDGHVNYKADPYAFYAQMRPETASIVWGL
EPFKWSDGAYMSARGLPFKKAMSVYEAHAGSWKAGLNYRQLAQELVRYAANMGYTHIELM
PVCEYPYDMSWGYQITGYYAITSRYGEPEDFKYFINCAHEAGLGVIADWVPAHFTRDAHG
LARFDGEAEYEHPDTRRSDQPQWGTLLFNYEKAEVQSFLISNAVYLLKEYHIDGLRVDAV
SCMLYLDYGRENGEWLPNEHGGNTNLSAVAFLRKLSRAVGRECPGALLIAEESTAFPLVT
APPEDGGLGFHLKWNMGWMNDTLSYMSMDSLFRKWHHSKLTFPMCYAFSENYILPFSHDE
VVHGKRSLIGRMPGSYEEKFLQLKLLFMYQFAQPGKKLMFMGCEFGQFIEWNHEQPLDWM
LLDYPQHSAVQRFVRELNALYVSTPALYEMDCGWEGFEWVSVDDADHSVIAFIRRDSEGG
SLLCVFNFTPVPQNAYRVRFSSPVILSSALSNQDPRFCGHVPPPRAELMSMKDHEGDYID
LFIPGYGGAYYHLNFQPVTAPLQAPKIQTN

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	168	467	3.5e-147	0.9933554817275747
CBM48	25	106	1.2e-20	0.881578947368421

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12313	PRK12313	0.0	4	558	6	569	1,4-alpha-glucan branching protein GlgB.
COG0296	GlgB	0.0	4	558	5	569	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK14705	PRK14705	0.0	3	556	597	1162	glycogen branching enzyme; Provisional
PRK14706	PRK14706	0.0	24	558	26	564	glycogen branching enzyme; Provisional
PRK05402	PRK05402	0.0	4	558	99	665	1,4-alpha-glucan branching protein GlgB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCX33360.1	2.86e-231	5	613	4	621
CBL01646.1	2.66e-227	6	613	13	633
ATL90043.1	4.66e-227	6	579	13	596
QIA41789.1	4.66e-227	6	579	13	596
ATO99826.1	4.66e-227	6	579	13	596

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K1D_A	4.73e-202	5	558	101	663	Crystalstructure of glycogen branching enzyme synonym: 1,4-alpha-D-glucan:1,4-alpha-D-GLUCAN 6-glucosyl-transferase from mycobacterium tuberculosis H37RV [Mycobacterium tuberculosis H37Rv]
1M7X_A	1.48e-195	12	563	1	561	TheX-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_B The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_C The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_D The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli]
4LPC_A	3.56e-195	22	563	6	556	CrystalStructure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_B Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_C Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_D Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LQ1_A Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_B Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_C Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_D Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],5E6Y_A Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_B Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_C Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_D Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_A Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_B Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_C Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_D Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_A Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_B Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_C Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_D Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A]
5GQW_A	1.10e-193	4	558	128	715	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR5_A	1.55e-193	4	558	128	715	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1VC54	3.69e-217	9	625	15	634	1,4-alpha-glucan branching enzyme GlgB OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) OX=391774 GN=glgB PE=3 SV=1
Q729V5	7.41e-217	9	625	15	634	1,4-alpha-glucan branching enzyme GlgB OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=glgB PE=3 SV=1
B8CVY1	2.25e-213	11	558	12	569	1,4-alpha-glucan branching enzyme GlgB OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) OX=373903 GN=glgB PE=3 SV=1
Q608L5	5.53e-213	5	564	105	674	1,4-alpha-glucan branching enzyme GlgB OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) OX=243233 GN=glgB PE=3 SV=1
Q1AZ86	1.74e-212	5	579	99	683	1,4-alpha-glucan branching enzyme GlgB OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1) OX=266117 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003843_00929.