CAZyme Information: MGYG000003844_00602

Basic Information

• Species: Ruminiclostridium_E sp900539195
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminiclostridium_E; Ruminiclostridium_E sp900539195
• CAZyme ID: MGYG000003844_00602
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374		44549.64	6.4402

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003844	2672388	MAG	United States	North America

• Gene Location: Start: 36714; End: 37838 Strand: +

Full Sequence      

MAYTTDFEKLKEQLNHDPDPTRPVSKQASENTVRLFDYLKSIYGKKHLAGQQYLQSEEVE
DLVYYHLTGKLPAVRGYDFMGVSSCKKTDDQVDRAIKWATQCGGIVTMCWHWYAPNDMND
YSKGSSFYYKTTGYDHKTCFDLCKGVTEGTAEYEFIIREIDMVSAELKRMAQLDIPVLWR
PLHEANGNWFWWGNHDEQHREAYKKLWYMIFDRMENYHKLTNLIWVWNGQDKCMEVNPNT
FDICGDDIYSVKEYDHSSQKERFRYMGKMAHGKMITLSECGYIPDPDEMKKDNAMWLWWL
PWWGKFVYKREGYKPVFDKDGYTVINEKYMTEDFMKRVMAHPDVIMREDLPWYDKDKHKL
PDALSANLERIKSK

Enzyme Prediction     

EC	3.2.1.78	3.2.1.100

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	24	348	8.1e-88	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	4.97e-42	24	304	1	284	Glycosyl hydrolase family 26.
COG4124	ManB2	1.23e-11	175	319	180	340	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL34792.1	6.92e-274	1	374	1	362
CBK96404.1	5.69e-273	1	374	1	362
CBK96003.1	2.73e-104	1	366	68	437
CBL34396.1	7.72e-104	1	366	68	437
AIQ56350.1	3.84e-78	10	351	2	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPF_A	4.24e-53	21	350	4	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3ZM8_A	1.58e-47	16	307	139	421	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HF2_A	3.07e-42	28	351	50	357	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
3WDQ_A	6.52e-41	23	351	34	353	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6Q75_A	2.27e-38	23	333	23	332	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	1.27e-49	1	323	157	466	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P55296	7.03e-49	14	356	139	466	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1
P55298	1.10e-48	24	359	157	468	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1
P55297	1.14e-48	24	359	159	470	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1
Q5AWB7	2.57e-47	21	307	26	324	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003844_00602.