CAZyme Information: MGYG000003844_02147

Basic Information

• Species: Ruminiclostridium_E sp900539195
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminiclostridium_E; Ruminiclostridium_E sp900539195
• CAZyme ID: MGYG000003844_02147
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
808	MGYG000003844_13|CGC1	93237.51	5.6554

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003844	2672388	MAG	United States	North America

• Gene Location: Start: 16798; End: 19224 Strand: +

Full Sequence      

MSNPFTYANKVRKKFKDPYWVAKNKYITYYEQLPIDEKVILLESQTATKISGNLFYILKY
LLTDEKYAGYTVYLSSWGRYVKSIKAILEHYGFENVNIIVYASDDYMRLLASAKYLINDA
TFPNYWIKKEGQVYINTWHGTPLKAMGRKVHNDVFFGNVQKNLVNADYLLYPNVFTKDVM
IRDYMLENISSNSYILGGYPRNTVFFDRDAEKKIREELEITDKKIYAYMPTWRGTVDKVG
VSKNDAYLMYYLYELDKRLTDDEIFYINIHPMAMHAKNTAEVSKLRHIKNFPAEYETYDF
LNIADVLVTDYSSVFFDYACTRKKVVLFPYDKDEYLCDRGMYMDMDDLPFPQVFDIDSLV
NELRSEKNYDDAEFVKTFCTWDNIDATAQLCDRTILGIDTGLTVAPVPNNGKENVLIYAG
NLDKNGITTSLRSLMNNIDLDKRNYYVSFCQGKAKRHGEQLATFSDKVSFFAVAEYFNLT
AANKTVNKLYKEHMISTKQYIKSLGKRIEQNFLRSYGNAKFDAAVQFCGYEDEIILLYSQ
FKGKNIIWVHNDMLAEIKTRSNQRKDLLEYAYHNYDKVVAVTDDIVAPTQELAGAGKKID
IVKNTIDYKTICEKGEQPIALDPTTKCSVEPEKFYEIMQSDAKKFINVGRYSPEKGHDRL
IDAFYKLWQKDNSIYLIIMGGNSRAKKYEALIAKVNEMGLSENVILLLAVSNPYPIIKAC
DGFVLSSLYEGFGLVLAEADILGLPIVSTDITGPRTFMNKYGGTLVENSEDGVYKGLEML
YNNEIKPINVDYEAYNQECVAEFEKLFE

Enzyme Prediction     

No EC number prediction in MGYG000003844_02147.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	641	784	6.4e-28	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	5.64e-61	34	393	1	357	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
cd03811	GT4_GT28_WabH-like	1.95e-52	414	800	1	345	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
COG1887	TagB	2.09e-35	30	373	19	354	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].
pfam00534	Glycos_transf_1	5.96e-28	641	797	1	158	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
cd03798	GT4_WlbH-like	5.13e-26	560	767	136	325	Bordetella parapertussis WlbH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Staphylococcus aureus CapJ may be involved in capsule polysaccharide biosynthesis. WlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK97012.1	0.0	1	808	1	808
CBL33357.1	0.0	1	808	1	808
QBE99381.1	1.97e-217	10	806	4	800
QJU15211.1	1.26e-215	10	807	4	801
QQQ92281.1	1.55e-206	26	808	20	797

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	2.35e-29	23	392	334	712	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7M_A	1.27e-28	23	392	334	712	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7J_A	1.68e-28	23	392	334	712	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8RKI5	5.10e-29	33	395	27	393	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
Q5HLM5	1.25e-28	23	392	334	712	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
Q2G1C1	2.30e-23	77	391	61	384	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
P13485	1.11e-21	32	364	376	706	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q8RKJ2	1.64e-19	30	389	250	596	Teichoic acid poly(ribitol-phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003844_02147.