CAZyme Information: MGYG000003845_00519

Basic Information

• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; 51-20
• CAZyme ID: MGYG000003845_00519
• CAZy Family: GT111
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
667		78370.67	6.6558

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003845	1510212	MAG	United States	North America

• Gene Location: Start: 4803; End: 6806 Strand: -

Full Sequence      

MKTKQPTIKILVGYHKPAVLLQDEVLTPIHLGRALATEASKDGAMSKEDYQWMLDNMIGD
DTGENISADNRFLNELTAIYWAWKNYDKLGNPDYIGFMHYRRHLSFNLNKHFDADIYGFV
LEQKLNDTYLAKYHLDAEHIIDIVGHYDVIVADKTDLTRLGTKNPYNHYENSERKLHIKD
YETVLDILCHKYPEYTEDAVSYNTSDYAYFTNVFIMKKEIFNDYCGWLFGILKEAQQKID
ISNYNIQETRALAYVSEWLCGIYITHLSRNGKKILELQESLILNTDILPEIKPAYAQNNI
PVCLSMDANYALYTGVAIQSIISNMSKANNYDILVLSQGVSTAEQKKIAQIADDYPNVSI
RFIEVKRYIDYFFTISHFSEAVYYRIFIAKILTAYDKVVYVDSDLVVTTDIAELYRTDIH
NNSLGAVQDTEVVRMYFTDGVITDYLDNILKIENPYDYFNSGVLIMNLKKMRTYDIESDF
ITVMGRIKSPYMVDQDVLNVMFQHDVMLLDGSWNYEYHLPIWHPNYAADLPVKVLEQYHH
SKKHAQIVHFAGSKKPWQYPQYEMSSYFWKYARQTPFYEEILQKNVLRINQPVIEQQMIV
KERVGYIDDYLLTKLKYAKYKLLSKIMLGQKRVSCRQKRKELKKEMKWIKNCYRMQEHDQ
YKQAANQ

Enzyme Prediction     

No EC number prediction in MGYG000003845_00519.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT111	10	266	1.3e-68	0.9907834101382489
GT8	296	559	1e-55	0.8910505836575876

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14393	DUF4422	3.01e-70	9	266	1	218	Domain of unknown function (DUF4422). This family of proteins is found in bacteria and archaea. Proteins in this family are typically between 255 and 371 amino acids in length.
cd04194	GT8_A4GalT_like	3.19e-60	300	559	1	248	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
COG1442	RfaJ	5.14e-38	298	646	1	325	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01501	Glyco_transf_8	3.83e-31	303	559	1	250	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
cd00505	Glyco_transf_8	8.59e-22	307	559	9	246	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXL32980.1	2.21e-149	4	627	2	621
ASN92820.1	1.66e-148	4	627	2	621
ASQ29972.1	6.68e-143	2	584	25	608
ALN43936.1	2.37e-123	6	587	8	583
QPK94470.1	7.40e-120	5	615	4	599

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6U4B_A	2.73e-109	7	586	28	597	ChainA, WbbM protein [Klebsiella pneumoniae]
1G9R_A	4.89e-15	302	557	3	252	ChainA, GLYCOSYL TRANSFERASE [Neisseria meningitidis],1GA8_A Chain A, GALACTOSYL TRANSFERASE LGTC [Neisseria meningitidis]
1SS9_A	2.14e-14	302	557	3	252	ChainA, alpha-1,4-galactosyl transferase [Neisseria meningitidis]
3TZT_A	9.40e-12	304	558	10	253	Thestructure of a protein in glycosyl transferase family 8 from Anaerococcus prevotii. [Anaerococcus prevotii DSM 20548],3TZT_B The structure of a protein in glycosyl transferase family 8 from Anaerococcus prevotii. [Anaerococcus prevotii DSM 20548]
5GVW_A	4.50e-11	375	572	80	251	Crystalstructure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_B Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_C Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_D Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25148	1.62e-16	307	557	14	255	General stress protein A OS=Bacillus subtilis (strain 168) OX=224308 GN=gspA PE=1 SV=2
A0A0H2URH2	2.52e-13	302	571	5	244	Glycosyltransferase GlyF OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyF PE=3 SV=1
P43974	8.35e-13	302	515	41	246	Putative glycosyltransferase HI_0258 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0258 PE=3 SV=2
A0A0H2URJ6	2.46e-10	375	572	80	251	Glycosyltransferase GlyE OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyE PE=1 SV=1
A0A0H2URH7	5.19e-09	376	558	374	527	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003845_00519.