CAZyme Information: MGYG000003845_00877

Basic Information

• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; 51-20
• CAZyme ID: MGYG000003845_00877
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
390		43637.23	9.955

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003845	1510212	MAG	United States	North America

• Gene Location: Start: 3200; End: 4372 Strand: +

Full Sequence      

MNNNLKIYLIAGEPSGDALGARLMRALKSKTAGKVEFFGIGGDTMEKEGMKSLFDISELA
IMGLCEVIPSIPKVLKRIRQTVDDILRIRPDVVISIDSWSFGSRVQKKLRTLKTGIPQVH
YVAPQVWAWKKKRAKTMHKYVDRLLTLLPQEPKYFTPYGLQTDFVGHPVIESPVINGDKE
VFRQKYKIDNDKKIICLLPGSRHNEVSRLLPVFLEAAELLKQQHPELFFVIPTVKTVAAR
VKAMLANASLPVLVVEGEEDRHNAMSAATAAIAASGTVALELAIADVPHIIGYKVAPLTA
ALVKHFLHIQFVNLSNILLGREIVPELLQERCIAANIVLYINRFLEQDSFYRYQKEGFQK
VRTILGLGEQKPSENAADIILNMIRQKNAA

Enzyme Prediction     

No EC number prediction in MGYG000003845_00877.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	7	364	3.8e-123	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.52e-144	4	387	1	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.61e-134	5	386	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.45e-99	7	380	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.15e-78	7	337	8	337	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	4.03e-48	6	383	3	347	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIM10250.1	3.52e-206	1	387	1	387
ANC91241.1	1.59e-117	7	387	13	393
AWU93490.1	8.34e-116	7	386	17	396
ARJ65449.1	2.67e-115	5	387	6	389
BAE51288.1	9.13e-115	7	386	3	383

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	2.37e-59	5	332	7	332	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	2.37e-59	5	332	7	332	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2W4D7	1.83e-115	7	386	3	383	Lipid-A-disaccharide synthase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) OX=342108 GN=lpxB PE=3 SV=1
B6IST7	1.93e-112	5	387	4	386	Lipid-A-disaccharide synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) OX=414684 GN=lpxB PE=3 SV=1
Q5FUA3	7.17e-88	7	386	31	407	Lipid-A-disaccharide synthase OS=Gluconobacter oxydans (strain 621H) OX=290633 GN=lpxB PE=3 SV=1
Q3SRI5	2.89e-85	2	389	8	394	Lipid-A-disaccharide synthase OS=Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255) OX=323098 GN=lpxB PE=3 SV=1
Q0BS63	3.32e-83	7	345	6	341	Lipid-A-disaccharide synthase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) OX=391165 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003845_00877.