CAZyme Information: MGYG000003846_00987

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312
• CAZyme ID: MGYG000003846_00987
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389		42982.25	9.6676

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003846	2141960	MAG	United States	North America

• Gene Location: Start: 52070; End: 53239 Strand: -

Full Sequence      

MGSGVLQTRNFDFPAPRNGRCDVLILAGEHSGDQQAARMLSEALQKRPNIEVCAFGGAAL
EGAGAQLLFDFTSFSVVGLMEVLKNYSFFKALSAAIVDWIGKYRPKAVCFVDYPGFNLHI
AALLHKKGISVNGGGNVKLLYYISPQIWAWKAKRRFKMARLLNSLAVIFPFETKCYADTD
LKTTFVGHPFLEPGYENPVRYDESGELLLLPGSREIAVGRIFPAMLGALRMLDSQRAVAL
YPSAGIKEVLENTLKNFPDVSGRVRIVDAAALPLKAKAVMMSSGTMSLSCSLAGIPGAIV
YKANPLTYVLGRMVVKIKYLSIANILLDRPAWREFIQFDASAQKIASYMKTCLRPEAREE
FLRYARELESLLRAKASHTAADWLLLEIQ

Enzyme Prediction     

No EC number prediction in MGYG000003846_00987.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	23	368	5.7e-87	0.980225988700565

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	3.33e-66	23	382	4	369	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.67e-62	23	389	4	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	4.07e-58	23	346	1	332	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.51e-46	23	346	8	338	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.38e-45	68	384	42	344	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACB75370.1	1.28e-134	14	385	10	384
AKC82833.1	1.59e-134	11	385	9	380
AHF91230.1	3.13e-133	11	385	10	398
ATC65221.1	1.34e-132	7	385	4	379
QXD30622.1	3.48e-128	1	384	1	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	3.06e-33	23	385	9	378	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	5.85e-33	23	385	9	378	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5WWX7	5.27e-53	23	388	7	379	Lipid-A-disaccharide synthase 1 OS=Legionella pneumophila (strain Lens) OX=297245 GN=lpxB1 PE=3 SV=1
Q5ZVR9	1.04e-52	23	388	7	379	Lipid-A-disaccharide synthase 1 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=lpxB1 PE=3 SV=1
Q5X5J5	1.64e-50	23	349	7	338	Lipid-A-disaccharide synthase 1 OS=Legionella pneumophila (strain Paris) OX=297246 GN=lpxB1 PE=3 SV=1
B6J9H1	5.24e-50	23	346	6	330	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuK_Q154) OX=434924 GN=lpxB PE=3 SV=1
A9KC41	5.24e-50	23	346	6	330	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003846_00987.