CAZyme Information: MGYG000003846_01711

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312
• CAZyme ID: MGYG000003846_01711
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
732		83510.63	6.0739

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003846	2141960	MAG	United States	North America

• Gene Location: Start: 7012; End: 9210 Strand: +

Full Sequence      

MIIRESELENIVGARCANIADYLGLHKCKGGLVARSYIIDAKKCFLVNEKTREKTQMQKL
HESGLFELFMPRKRALFKHHFEVEDYRGGIRKVYDSYAFESQFSEFEIYLIGKGDDRKIY
QKMGSHPYSIDGIEGVSFAVWAPTARRVSVVGDFNGWDGRYNQMRPVGVSGIWEIFVPGA
KVGQKYKYEILAANNDTPFLKIDPYAVYFEAPPNNSSIIWSLEGYEWGDGQWIKRREQTD
WAKAPVSVYEVHLGSWMRVDGDGGRPLSYVEAGEKLSEYCRQMNFTHVEFLPLSEYPFPG
SWGYQVTGFYAPTHRYGTPQQFMQMVDTLHKNGIGVIMDWVPAHFPRDSFALAGYDGSCL
YEHEDPRLGANPDWGTLCFNYGRPEVSNFLMGSALAWFDRFHVDGLRVDAVASMLYLNFS
RSQWIPNRFGGAENLEAIEFLKHTNDAVHGEFKGALMIAEESTTFEGVTKPTKDGGLGFD
FKWNLGWMHDTLDYMKENPVNRKYHHNKITFPSMFQFTEKFMLVYSHDEVVHGKSPMVGK
MGCFDWNEKLANLRALYAFMWFWPGKKTLFMGDEIAQSTEWRYDGSVEWHLLDFDVHRAV
QSVVRDAAGLYKADRGLAANDFNPGGFKWINADDGNYSVYSFLRFDDDGKTCYAVISNFT
PVKRQEYGLGLPFKGKWREVLNTDALCYCGSGAGNCGGVEAEELPMNNLPYGALLTLPPM
STLVLKYEDTPL

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	278	577	7.4e-142	0.9966777408637874
CBM48	122	208	9.4e-20	0.8947368421052632

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12313	PRK12313	0.0	101	729	5	629	1,4-alpha-glucan branching protein GlgB.
COG0296	GlgB	0.0	105	727	8	628	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK14705	PRK14705	0.0	79	720	572	1215	glycogen branching enzyme; Provisional
PRK14706	PRK14706	0.0	123	727	27	621	glycogen branching enzyme; Provisional
PRK05402	PRK05402	0.0	3	730	1	726	1,4-alpha-glucan branching protein GlgB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYY37490.1	6.79e-304	27	727	7	709
QXD26686.1	3.66e-295	1	728	1	736
QXD22608.1	3.66e-295	1	728	1	736
AKC82531.1	4.08e-294	1	729	1	735
ADE53954.1	1.12e-287	25	728	1	711

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GQW_A	1.77e-239	21	730	43	776	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR5_A	5.03e-239	21	730	43	776	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQZ_A	7.12e-239	21	730	43	776	Crystalstructure of branching enzyme Y500A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQU_A	1.01e-238	21	730	43	776	Crystalstructure of branching enzyme from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQV_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltohexaose [Crocosphaera subtropica ATCC 51142],5GQY_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR2_A	2.86e-238	21	730	43	776	Crystalstructure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GR4_A Crystal structure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q11EX1	1.29e-248	11	728	21	737	1,4-alpha-glucan branching enzyme GlgB OS=Chelativorans sp. (strain BNC1) OX=266779 GN=glgB PE=3 SV=1
B3PGN4	1.16e-246	33	726	44	735	1,4-alpha-glucan branching enzyme GlgB OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=glgB PE=3 SV=1
Q2RR72	5.16e-246	11	732	13	736	1,4-alpha-glucan branching enzyme GlgB OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1) OX=269796 GN=glgB PE=3 SV=1
Q8DLB8	5.02e-245	1	728	1	751	1,4-alpha-glucan branching enzyme GlgB OS=Thermosynechococcus vestitus (strain IAM M-273 / NIES-2133 / BP-1) OX=197221 GN=glgB PE=3 SV=1
Q165E2	6.15e-245	1	729	1	730	1,4-alpha-glucan branching enzyme GlgB OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) OX=375451 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003846_01711.