CAZyme Information: MGYG000003858_00545

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UMGS363
• CAZyme ID: MGYG000003858_00545
• CAZy Family: GH5
• CAZyme Description: Endoglucanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326		37684.5	4.9778

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003858	2536747	MAG	United States	North America

• Gene Location: Start: 35674; End: 36654 Strand: +

Full Sequence      

MRNISSAELLKEWTAGWNVGNSLDACKCGGLESEESWHNPKVTQKLIDGVISTGINVIRV
PATWSNHLDENYNIDAAWMDRVQEVVDYAYKRGVFVILNTHHENFLYTSQENYPKASEIL
VRVWEQICERFGNYGERLLFEGLNEPRKNGAPDEWHCTDEEAFDVVNKLNTDFVKTVRSG
GEKNAIRHLVLATYCGACTDEIMRSLEIPDDDKIIVNVHSYIPWNFAAEKNGLEVFNETA
ELDATFGYMKKYVIDKNVPLIIDEFGAVDRENTAERIKYLEYFKSKAYALGIKYLWWDNG
YRRSFALFDRKNGKPYFKEIVETLVR

Enzyme Prediction     

EC	3.2.1.4	3.2.1.73

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	34	300	5.3e-87	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	5.85e-54	30	301	12	270	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	8.31e-21	8	301	46	361	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAF00074.2	6.22e-94	1	324	1	342
AAD43818.1	1.25e-92	1	324	104	445
AAC05164.1	1.37e-92	1	326	21	364
ADK66823.1	6.65e-92	1	326	28	364
AAB69347.1	1.73e-90	1	326	21	364

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AYR_A	3.52e-95	1	324	15	356	GH5endoglucanase EglA from a ruminal fungus [Piromyces rhizinflatus]
3AYS_A	2.82e-94	1	324	15	356	GH5endoglucanase from a ruminal fungus in complex with cellotriose [Piromyces rhizinflatus]
4IM4_A	6.83e-80	1	326	2	333	ChainA, Endoglucanase E [Acetivibrio thermocellus],4IM4_B Chain B, Endoglucanase E [Acetivibrio thermocellus],4IM4_C Chain C, Endoglucanase E [Acetivibrio thermocellus],4IM4_D Chain D, Endoglucanase E [Acetivibrio thermocellus],4IM4_E Chain E, Endoglucanase E [Acetivibrio thermocellus],4IM4_F Chain F, Endoglucanase E [Acetivibrio thermocellus]
6WQP_A	5.33e-75	1	326	11	354	GH5-4broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQP_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQV_A GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_C GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_D GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis]
6PZ7_A	9.66e-74	3	325	6	334	GH5-4broad specificity endoglucanase from Clostridium acetobutylicum [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q12647	4.31e-85	1	326	20	361	Endoglucanase B OS=Neocallimastix patriciarum OX=4758 GN=CELB PE=2 SV=1
P23660	3.01e-82	1	325	22	360	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1
P16216	1.46e-78	5	323	68	393	Endoglucanase 1 OS=Ruminococcus albus OX=1264 GN=Eg I PE=1 SV=1
P23661	2.22e-75	5	322	70	394	Endoglucanase B OS=Ruminococcus albus OX=1264 GN=celB PE=3 SV=1
P10477	1.41e-74	1	326	52	383	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003858_00545.