CAZyme Information: MGYG000003859_00938

Basic Information

• Species: 51-20 sp001917175
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; 51-20; 51-20 sp001917175
• CAZyme ID: MGYG000003859_00938
• CAZy Family: GT111
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
664	MGYG000003859_17|CGC1	78400.96	8.3448

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003859	1621181	MAG	United States	North America

• Gene Location: Start: 23231; End: 25225 Strand: -

Full Sequence      

MKKKKPTVKILVGYHRPAVLLKDEVLIPIHLGRALATEASKDGSMSKEDYQWMLDNMIGD
DTGENISEENRKYCELTALYWAWKNYDKLGNPDYIGFMQYRRHFIFDDGFDGTGREKPWG
CFRFSGIDDSYVDMLSLRGDKIVAYLEKHPADVLTTKEVSFGQTVAEHYAQTLSFLNPDD
LRICARKAALLFPEYKSAIRKYLRSKKHYWYHSFIMKKEIFFEYCEWLFKILFATEKEID
YQDYTIAAYRTPAYLGERLWGIFFNGKKNVCRTRELELSIVDDVSRSRDIRPAFERNNTA
ICFACDDNYVPYLSVVLQSLTEHAGSGNNYDIVIIENGVEPYNQKLLTETYAGGNVSIRF
YNVSDVYEKYKEMFYSHGYYTPTVYFRFFIPEIFAHYEKVLYLDSDLICLRDIADLYRVD
IGGNLLGAVRDVEYARIYNENCEIKGCRVKDYCDDILKLKDYTHYFNSGVLGFNIKKCRE
FALTDKLLKRLAEVKNPMIVDQDIFNSVCEGRIFYYSPDWNVEWHTYYLYGNLLPYQLPR
DFYEKYLEAIKNPSILHYAVDMKPWDCPEHSTAEIFWHYAQKTPFFARIIYKHFEQKIYA
LSRQKPAVQVAEVKKIPLKDKLKYYRYKFLSFAAFGPKKSYYGEKKRKMKQKIKSIRSRE
LPAC

Enzyme Prediction     

No EC number prediction in MGYG000003859_00938.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT111	10	265	7e-64	0.9861751152073732
GT8	296	566	4.4e-58	0.8832684824902723

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14393	DUF4422	3.61e-64	9	263	1	215	Domain of unknown function (DUF4422). This family of proteins is found in bacteria and archaea. Proteins in this family are typically between 255 and 371 amino acids in length.
cd04194	GT8_A4GalT_like	5.57e-63	300	565	2	246	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
pfam01501	Glyco_transf_8	2.08e-41	301	565	2	248	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
COG1442	RfaJ	2.00e-34	300	586	4	267	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
cd00505	Glyco_transf_8	3.02e-22	304	566	7	245	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXL32980.1	7.98e-149	4	596	2	580
ASN92820.1	5.98e-148	4	596	2	580
ASQ29972.1	5.28e-141	2	592	25	608
QPK94470.1	2.28e-117	5	622	4	606
ALN44019.1	7.74e-115	8	590	356	940

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6U4B_A	5.32e-80	7	566	28	569	ChainA, WbbM protein [Klebsiella pneumoniae]
1SS9_A	1.81e-20	301	567	3	256	ChainA, alpha-1,4-galactosyl transferase [Neisseria meningitidis]
1G9R_A	8.08e-20	301	567	3	256	ChainA, GLYCOSYL TRANSFERASE [Neisseria meningitidis],1GA8_A Chain A, GALACTOSYL TRANSFERASE LGTC [Neisseria meningitidis]
5GVV_A	5.44e-09	387	580	90	251	Crystalstructure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVV_F Crystal structure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]
5GVW_A	5.44e-09	387	580	90	251	Crystalstructure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_B Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_C Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_D Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0H2URH2	5.94e-15	300	579	4	244	Glycosyltransferase GlyF OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyF PE=3 SV=1
P27129	2.96e-10	381	565	106	272	Lipopolysaccharide 1,2-glucosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaJ PE=3 SV=2
P19817	1.23e-09	301	565	28	270	Lipopolysaccharide 1,2-glucosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaJ PE=3 SV=4
Q9AEU2	1.69e-09	383	579	92	253	Probable glycosyl transferase Gly OS=Streptococcus gordonii OX=1302 GN=gly PE=3 SV=2
A0A0H2URH7	3.91e-09	275	579	285	541	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003859_00938.