CAZyme Information: MGYG000003867_00906

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Catenibacillus
• CAZyme ID: MGYG000003867_00906
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
418	MGYG000003867_29|CGC1	46652.73	4.4119

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003867	2363031	MAG	United States	North America

• Gene Location: Start: 1250; End: 2506 Strand: +

Full Sequence      

MEISQIPPVMTNTQSFGKLRVSVTSELTYTPIPDATINIAYAGQTNAIEQLKTDVSGQSE
TIELTTPPAEYSLEPEGIQPYSEYTLTISAPNYETAIINNTQLLSGETAIQPVQLMPLQT
VSDDIVIPAHTLYGTYPPKIPEAEIKPITESGEIVLSRVVIPETIVVHTGPPNDAGAKNY
YVPYKDYIKNVASSEIYATWPENTIIANVLAIMSFTLNRVYTEWYRNKGLNFTITNSTAY
DHFFVPGRNIFESISEVVDTIFANYLSRPNVRQPILTQYCDGKRVSCPQWMSQWGSKTLG
EQGYEPIEILRYYYGEDIYINTAEQISGIPSSWPGSDLTIGSRGSKVMQMQEQLNRIAQN
YPALPIIAADGIYGPATANAVREFQKVFNLPQTGIVDYRTWYKISEIYVGVSRIAELT

Enzyme Prediction     

No EC number prediction in MGYG000003867_00906.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01471	PG_binding_1	3.01e-15	343	404	1	57	Putative peptidoglycan binding domain. This domain is composed of three alpha helices. This domain is found at the N or C-terminus of a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. This family is found N-terminal to the catalytic domain of matrixins. The domain is found to bind peptidoglycan experimentally.
COG3409	PGRP	3.77e-08	338	404	39	102	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
COG3409	PGRP	1.95e-06	334	404	117	183	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
TIGR02669	SpoIID_LytB	1.14e-04	291	314	237	260	SpoIID/LytB domain. This model describes a domain found typically in two or three proteins per genome in Cyanobacteria and Firmicutes, and sporadically in other genomes. One member is SpoIID of Bacillus subtilis. Another in B. subtilis is the C-terminal half of LytB, encoded immediately upstream of an amidase, the autolysin LytC, to which its N-terminus is homologous. Gene neighborhoods are not well conserved for members of this family, as many, such as SpoIID, are monocistronic. One early modelling-based study suggests a DNA-binding role for SpoIID, but the function of this domain is unknown. [Unknown function, General]
pfam13620	CarboxypepD_reg	0.003	31	115	13	81	Carboxypeptidase regulatory-like domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT50293.1	4.73e-205	13	418	9	419
QEI32542.1	5.15e-200	17	417	24	429
QHB25032.1	5.15e-200	17	417	24	429
QRT31086.1	5.54e-200	17	417	26	431
QJU21247.1	1.87e-194	15	417	9	415

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003867_00906.