CAZyme Information: MGYG000003868_01618

Basic Information

• Species: Phascolarctobacterium sp900545535
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium; Phascolarctobacterium sp900545535
• CAZyme ID: MGYG000003868_01618
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
275	MGYG000003868_13|CGC1	30373.97	4.7056

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003868	2553728	MAG	United States	North America

• Gene Location: Start: 26223; End: 27050 Strand: -

Full Sequence      

MFKILVLIIAAVSIFFWYPASGDPIQKDVAKPAPQHTVQQPSEHSQATVFLLSLLPPKQE
WPDPVQKIWLSLNIEEAVQERTNDIDWVPITEIPIEMQQALLAIEDHNFYSHGAIDIDGI
LRAALVNITAGEVVQGGSTITQQLTKNLFLSQEQTLSRKAEEALLALVMEQYYSKDQLLE
IYFNTTYFGAGATGLKAAALTYFAKQPQELQLAECAVIASLPYAPSVLNPLENPEGCKKR
QLLVLQTMVKRGYIGTTLAEKAASAPVYLANGTTF

Enzyme Prediction     

No EC number prediction in MGYG000003868_01618.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	82	249	1.3e-63	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	9.40e-81	86	249	14	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	1.06e-72	51	275	44	267	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.14e-72	88	267	70	249	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	2.27e-51	88	267	69	248	penicillin-binding protein 1a; Provisional
COG4953	PbpC	1.04e-44	87	271	60	243	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBG64464.1	1.00e-167	1	275	1	276
QNP76977.1	8.21e-167	1	275	1	276
QTV77901.1	8.17e-91	1	273	1	272
AJQ29176.1	5.72e-63	51	270	30	253
AIF50162.1	2.29e-62	61	270	48	253

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	8.03e-51	61	264	4	199	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	3.20e-50	61	264	4	199	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	5.11e-39	88	267	42	221	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3UDF_A	1.61e-36	88	269	42	223	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
5U2G_A	2.60e-36	88	267	43	222	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O66874	9.09e-47	50	267	19	245	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
Q07259	1.22e-45	86	269	48	230	Putative transglycosylase H16_A0665 OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=H16_A0665 PE=3 SV=2
Q1RKC5	3.28e-42	61	269	44	254	Penicillin-binding protein 1A OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=mrcA PE=3 SV=1
O87626	1.17e-41	86	262	69	245	Penicillin-binding protein 1A OS=Neisseria flavescens OX=484 GN=mrcA PE=3 SV=1
Q4UK08	2.92e-41	61	269	44	254	Penicillin-binding protein 1A OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.008465	0.990351	0.000513	0.000250	0.000200	0.000200

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003868_01618.