CAZyme Information: MGYG000003869_01222

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; Flavonifractor
• CAZyme ID: MGYG000003869_01222
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
552	MGYG000003869_30|CGC1	59988.25	4.5822

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003869	2306830	MAG	United States	North America

• Gene Location: Start: 17668; End: 19326 Strand: +

Full Sequence      

MRKRRICAAALTAVLLLSAAPLSPQARAFSDTSGHWAQADIDKAQSYGLMEGYPDGRFGI
GVEITRAEFVTILCRMFDWEMISPTSPSYIDCGTGEWYYSAVETARAHDVMDGAGAFRPL
DYISREEMAVMLVRALGYDTLAQDLSSLSLPFTDVKNNVGYIAIAYDIGMIKGVAGPGGQ
LKFLPTHSATREEAAAMLVRVYERYNSKVDWLHGFYAFSSYSQINLAADMDAVSVGWARL
EYGADGATLNSTNSGGNDWVKPSDPTPATDYFTSHGVDYNLCVFGSATDSVTLADGSTTS
TVAAVVNDSNARAQAISALVEAAGSYAGLTIDFEGLKGDTIKKNYVTFMEELRAALPKDK
TLNVCVQPDTWYTGFDYRGLGAVCDKVILMAHDYQWTSVPASYVGTGNTDSPVTPFASVY
ETLRDITDPDTGVQDVSKIALAISFGTAGFHIDENGRLLETTIYHPGTDTLAGRLAQPDT
VVTYSEKYRNPYAIYTNEEGERYKVWYEDARSVADKLQLAKLFGITGVSLWRVGTIPAST
GYNVWSAVQAAR

Enzyme Prediction     

No EC number prediction in MGYG000003869_01222.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	233	534	6.6e-31	0.777027027027027

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	3.30e-29	302	534	78	303	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	2.25e-24	295	534	175	408	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd06549	GH18_trifunctional	2.06e-21	295	540	72	297	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
smart00636	Glyco_18	6.77e-12	303	531	83	329	Glyco_18 domain.
NF033190	inl_like_NEAT_1	7.87e-12	29	198	582	748	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR07612.1	3.05e-285	3	552	2	553
ANU39561.1	3.05e-285	3	552	2	553
QIA29094.1	6.14e-285	3	552	2	553
ALP95751.1	2.55e-216	9	552	8	560
QBB67439.1	7.27e-216	9	552	8	560

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CZ8_A	4.22e-14	296	533	80	308	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4S3J_A	1.22e-12	305	534	189	411	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
4S3K_A	6.49e-11	304	534	189	413	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05495	6.52e-14	296	533	172	400	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
P06546	4.46e-12	4	275	2	286	Middle cell wall protein OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) OX=358681 GN=BBR47_54160 PE=4 SV=4
P37531	4.97e-12	305	534	186	409	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
P0DPJ9	1.16e-11	305	534	188	410	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
Q9K3E4	2.72e-11	305	534	188	410	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002023	0.995491	0.000777	0.000759	0.000461	0.000462

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003869_01222.