CAZyme Information: MGYG000003871_00958

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; RUG11247
• CAZyme ID: MGYG000003871_00958
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
559		62035.76	5.0185

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003871	1678066	MAG	United States	North America

• Gene Location: Start: 1314; End: 2993 Strand: -

Full Sequence      

MFRPHAYETDPRVRKYIVPLRVVRTTGDVSGQEWLTQERPGQISLEKPDFWPPCILKNSG
GERASVLVDFGCEIHGSVRLYSWYVHPASGNRVNLRLRFGESVSEAMTPYPEKGSTNDHA
NRDMLMNVGFLSANETNESGFRFLNVELMDDDASIELYMLQGVMITRDIPRIGTFVCDDE
RVNDIYETSVYTAYLNMQEYLWDGIKRDRLVWCGDIYPSELTILSAFGAHGILGKSLDLH
ALITPPESWMNGMPTYSLWWLLSQDLLYMAGGDLEYLRKHHDYMARFVKRVANECIAPDG
SECLPGDGFLDWPSSTNPGAIHAGQQALMAMAFDRTAFMMDKMGDSETAALCRNCRDRLA
KVKLPHSGSKQAAAMLALSGIESPEKMNDEVIAPGGGHGYSTFLGYTILAAKGEAGDIAG
AINDMKEYWGGMLDMGATTFWEDFNLDWMANATPIDEPVPQGKDDIHSDFGAYCYKNLRH
SLCHAWASGPAPFLMKYVLGIRILEPGCKKVAVRPCLGGLKWAEGAYPTPMGAIKVRCEQ
GADGLKVAVDAPEGIEIVK

Enzyme Prediction     

No EC number prediction in MGYG000003871_00958.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	64	556	2.3e-85	0.9761904761904762

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.88e-22	170	498	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.09e-09	500	554	1	56	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEC52590.1	1.80e-179	8	559	37	587
ACU04507.1	1.43e-177	5	559	21	572
BBE16159.1	2.27e-177	13	558	39	583
QRR03982.1	1.45e-176	8	559	29	579
QNL50446.1	1.72e-175	14	559	40	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	8.69e-38	38	554	169	688	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	9.87e-21	65	499	94	543	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003871_00958.