CAZyme Information: MGYG000003871_01555

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; RUG11247
• CAZyme ID: MGYG000003871_01555
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
205		22564.74	5.287

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003871	1678066	MAG	United States	North America

• Gene Location: Start: 114; End: 731 Strand: -

Full Sequence      

MAHTRRRRRADCLGKAIIVLAALAAAAVIAVMMLRLKDSRAAKYPVLYVDEICAAAAENS
IPAPYIAAVIMAESSYDPHAVSSVGAQGLMQIMPETGRWISGKLDDEYTDQRMFDPGACI
RYGSWYLGFLMDRYSGDMRCATAAYHAGQGTVDKWLADPAYSSDGVTLSQIGYDTTSVYV
ERVLKYYEYYANAYAELESAAETMK

Enzyme Prediction     

No EC number prediction in MGYG000003871_01555.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	63	192	1.6e-29	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	5.40e-63	45	185	1	142	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.07e-42	44	184	2	143	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	6.04e-34	66	185	4	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	2.90e-30	54	157	3	104	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	3.73e-26	38	184	129	277	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUA53916.1	2.83e-36	43	194	305	459
CDM68683.1	8.26e-35	44	194	29	180
QNK41497.1	1.06e-34	6	194	2	188
QEY33915.1	1.08e-33	44	194	37	188
AGB40428.1	1.29e-33	44	196	33	186

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	5.65e-17	38	186	439	588	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	5.73e-17	38	186	468	617	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FCQ_A	1.41e-16	38	186	439	588	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FC4_A	1.42e-16	38	186	440	589	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
1QSA_A	6.53e-16	35	190	440	598	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC4	3.62e-15	35	190	467	625	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	3.62e-15	35	190	467	625	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P39434	9.03e-15	35	199	467	634	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O31608	3.46e-12	55	179	67	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	5.33e-11	38	161	1412	1527	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999976	0.000057	0.000000	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
12	34