CAZyme Information: MGYG000003875_00506

Basic Information

• Species: Firm-11 sp900540045
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; Firm-11; Firm-11 sp900540045
• CAZyme ID: MGYG000003875_00506
• CAZy Family: CE1
• CAZyme Description: Endo-1,4-beta-xylanase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349	MGYG000003875_4|CGC1	39423.85	5.2357

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003875	3247365	MAG	United States	North America

• Gene Location: Start: 954; End: 2003 Strand: +

Full Sequence      

MRQDTCFQQATAFQLIPSEDGVFFEQDGRTRFCLNAPKATSLAVSLPGGPCWPLEKGEDG
RWRGTLELEGGFRYVDILMDGETVLLPQLPIGFGYSRTVNFLDVPAKEDGYYQLQDVPHG
SVARHYYPSTVTGNTESCLIYCPPDSEGRPLPILYLQHGLGENETGWVHQGRINFIMDNL
LAQGRVRPMRIVMGNGMVQIDGGISTSAFPRVLVQDLIPYAESAYPTMKGKWNHAVAGLS
MGSMHASAASMTHPELFGYVGLFSGFLRMLWENEQPHLKALDDPEAFARNYRVFFRAMGE
RDEFFSVFEEDDRLLASKGVQVMRKVYDGKHEWQVWRECARDFLPLLFQ

Enzyme Prediction     

No EC number prediction in MGYG000003875_00506.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	129	345	4.7e-44	0.9691629955947136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	5.08e-28	91	349	39	297	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
cd02858	E_set_Esterase_N	1.92e-17	28	105	1	78	N-terminal Early set domain associated with the catalytic domain of esterase. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
pfam00756	Esterase	4.55e-15	140	337	12	236	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG0627	FrmB	6.86e-13	146	347	49	308	S-formylglutathione hydrolase FrmB [Defense mechanisms].
cd02853	E_set_MTHase_like_N	3.07e-06	21	85	1	65	N-terminal Early set domain associated with the catalytic domain of Maltooligosyl trehalose trehalohydrolase (also called Glycosyltrehalose trehalohydrolase) and similar proteins. E or "early" set domains are associated with the catalytic domain of Maltooligosyl trehalose trehalohydrolase (MTHase) and similar proteins at the N-terminal end. This subfamily also includes bacterial alpha amylases and 1,4-alpha-glucan branching enzymes which are highly similar to MTHase. Maltooligosyl trehalose synthase (MTSase) and MTHase work together to produce trehalose. MTSase is responsible for converting the alpha-1,4-glucosidic linkage to an alpha,alpha-1,1-glucosidic linkage at the reducing end of the maltooligosaccharide through an intramolecular transglucosylation reaction, while MTHase hydrolyzes the penultimate alpha-1,4 linkage of the reducing end, resulting in the release of trehalose. The N-terminal domain of MTHase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUC66034.1	1.71e-107	17	349	20	361
CBK94454.1	1.02e-75	29	349	45	368
CBK90399.1	1.14e-74	52	349	67	368
CAC9484609.1	1.28e-66	19	349	47	412
CAM67498.1	1.28e-66	19	349	47	412

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RZO_A	7.01e-64	27	349	22	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZO_B	7.21e-64	27	349	22	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6MOT_A	4.48e-55	26	349	23	359	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6MOU_A	7.78e-55	26	349	44	380	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393],6MOU_B Chain B, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6NE9_A	2.50e-52	29	349	49	382	ChainA, Isoamylase protein [Bacteroides intestinalis],6NE9_B Chain B, Isoamylase protein [Bacteroides intestinalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EY13	5.17e-49	17	349	390	726	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
D5EXZ4	4.54e-40	16	349	323	670	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P31471	1.35e-27	31	349	52	389	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
P10478	1.13e-25	110	346	38	275	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
O31630	3.30e-06	119	337	5	229	Uncharacterized protein YjcH OS=Bacillus subtilis (strain 168) OX=224308 GN=yjcH PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003875_00506.