CAZyme Information: MGYG000003878_00005

Basic Information

• Species: Prevotella oris
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella oris
• CAZyme ID: MGYG000003878_00005
• CAZy Family: GH67
• CAZyme Description: Extracellular xylan exo-alpha-(1->2)-glucuronosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
648	MGYG000003878_1|CGC1	73487.44	6.8735

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003878	2959023	MAG	United States	North America

• Gene Location: Start: 4339; End: 6285 Strand: -

Full Sequence      

MKQTILSLLLALSPLLSPAEDGHALWLRYKPCGKANIIAPQGGATLQTAVDELKRYWQGS
ELKLILNPRLKDDDGFLYNGDSICSHSELGLLYGAYEALRLQAQEAYPRLGGYTAPKFSR
RILNHWDNLDGTIECGYAGKSIFFSANLKGQEWAGRIREYGRANASVGINGSVLNNVNAS
PKVLTTQYIDTVCTIANILRPYGIKVYLSVNFGSPKALGYTKTADPLDETVKKWWKKKAD
EIYQRIPDFGGFLVKANAEGQPGPFDYGRTHAEGANMLADVLALHGGIVMWRSSVYGAKH
KGEDRVMQAVSEFKDLDGLFKSNVILQSKNGPLDFQPREPYAPIFDNMKKTQQAVEFQIT
QEYTGQGKHLVFLAPMWKEFFSFVAPDSLKAIAGVSNIGDDINWCGHPFSQANWYAFGRL
AWNPSFSSDFIAQEWIGQTFGNEVNSYILADMMTTSREACVDYMMPLGLHHLFASQHHYG
PEADGVKAEYPLEWCPIPYHKAAADGIGFDRSSKGTNAVSQYREPYRSLYDNLATCPDEY
LLWFHHVPWDYKLHNGDMLWDELCALYYRGIEQVVSYQKLWNELRPQIDQERWEHVNRLL
ALQLENAKECRDYVLRYFQQFSKMPLKYNFTGVSYMPVQPAQLNHKQP

Enzyme Prediction     

EC	3.2.1.139	3.2.1.131	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH67	82	628	2.2e-238	0.8430493273542601

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3661	AguA2	0.0	20	628	5	677	Alpha-glucuronidase [Carbohydrate transport and metabolism].
pfam07488	Glyco_hydro_67M	0.0	100	403	1	324	Glycosyl hydrolase family 67 middle domain. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the central catalytic domain of alpha-glucuronidase.
pfam07477	Glyco_hydro_67C	1.24e-117	405	631	1	223	Glycosyl hydrolase family 67 C-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the C terminal region of alpha-glucuronidase which is mainly alpha-helical. It wraps around the catalytic domain (pfam07488), making additional interactions both with the N-terminal domain (pfam03648) of its parent monomer and also forming the majority of the dimer-surface with the equivalent C-terminal domain of the other monomer of the dimer.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH16569.1	0.0	1	648	1	648
BCS85458.1	0.0	1	638	1	638
ADI70674.1	8.87e-293	1	627	1	629
QNT67391.1	1.68e-278	1	626	1	666
QVJ81894.1	5.92e-262	1	623	1	638

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQI_A	5.86e-174	20	630	1	675	Structureof Pseudomonas cellulosa alpha-D-glucuronidase [Cellvibrio japonicus],1GQI_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase [Cellvibrio japonicus],1GQJ_A Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with xylobiose [Cellvibrio japonicus],1GQJ_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with xylobiose [Cellvibrio japonicus],1GQK_A Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid [Cellvibrio japonicus],1GQK_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid [Cellvibrio japonicus],1GQL_A Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid and xylotriose [Cellvibrio japonicus],1GQL_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid and xylotriose [Cellvibrio japonicus]
1H41_A	4.68e-173	20	630	1	675	Pseudomonascellulosa E292A alpha-D-glucuronidase mutant complexed with aldotriuronic acid [Cellvibrio japonicus],1H41_B Pseudomonas cellulosa E292A alpha-D-glucuronidase mutant complexed with aldotriuronic acid [Cellvibrio japonicus]
1MQP_A	6.18e-166	26	628	9	673	TheCrystal Structure Of Alpha-D-Glucuronidase From Bacillus Stearothermophilus T-6 [Geobacillus stearothermophilus]
1K9D_A	8.73e-166	26	628	9	673	The1.7 A crystal structure of alpha-D-glucuronidase, a family-67 glycoside hydrolase from Bacillus stearothermophilus T-1 [Geobacillus stearothermophilus],1L8N_A The 1.5A crystal structure of alpha-D-glucuronidase from Bacillus stearothermophilus T-1, complexed with 4-O-methyl-glucuronic acid and xylotriose [Geobacillus stearothermophilus],1MQQ_A THE CRYSTAL STRUCTURE OF ALPHA-D-GLUCURONIDASE FROM BACILLUS STEAROTHERMOPHILUS T-1 COMPLEXED WITH GLUCURONIC ACID [Geobacillus stearothermophilus]
1MQR_A	1.74e-165	26	628	9	673	ChainA, ALPHA-D-GLUCURONIDASE [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3PC73	2.12e-174	11	630	16	699	Extracellular xylan exo-alpha-(1->2)-glucuronosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=gla67A PE=1 SV=1
Q09LY5	3.38e-165	26	628	9	673	Xylan alpha-(1->2)-glucuronosidase OS=Geobacillus stearothermophilus OX=1422 GN=aguA PE=1 SV=1
P96105	9.31e-158	73	625	85	665	Xylan alpha-(1->2)-glucuronosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=aguA PE=1 SV=2
A1CC12	1.24e-133	1	622	1	684	Probable alpha-glucuronidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=aguA PE=3 SV=1
Q5AQZ4	2.08e-133	8	625	6	694	Alpha-glucuronidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aguA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001641	0.996807	0.000675	0.000287	0.000276	0.000284

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003878_00005.