CAZyme Information: MGYG000003878_00208

Basic Information

• Species: Prevotella oris
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella oris
• CAZyme ID: MGYG000003878_00208
• CAZy Family: GH27
• CAZyme Description: Isomalto-dextranase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
483	MGYG000003878_5|CGC1	54397.34	5.658

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003878	2959023	MAG	United States	North America

• Gene Location: Start: 35586; End: 37037 Strand: +

Full Sequence      

MKKYILASLAFATLLSGCNSNEWDVTSDLSVDKTDPTIGLTPVAEKPGMDYAPLYWSLYG
NLYDQEQARSFPNIFTPNDWDTAIDYVATNLKPYGYDMLVTDGFASMSGENGYMTRYSHT
QKDNTSPEVRLSDIVAKLSAKGLKLGVYDSPFWLHYDNGDAVIPGTDGIKVSSLRFNPKT
DKVLHPEKEDYFWWVNTSHPGAEQFFEGFFKHYADLGVHFVRMDFLSWYEDGMNYTDVID
KGYGRENYVRGMQWICKYAQKYGVYVSLVMPHLKDNAIIEKYAGNMVRIDADALKGGWFR
FSENNRGNIRGGWPNSETAFDGFVNWSKISGRKKIRLDGDFIRIGSYANDDEKMSVVSLP
LMAGGPVAATDMPTGHDLSFFQNAELLALQKDGFVGQPVARDLWNTDGEMWYGQMKDGSW
VIGLFNRSADTALRSLELSKIGLTGTWKVRDLWKHADEGKVSEKIEASVPSHGCKIVKLT
KAN

Enzyme Prediction     

No EC number prediction in MGYG000003878_00208.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH27	191	458	3.1e-28	0.9388646288209607

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17801	Melibiase_C	1.56e-15	409	479	5	74	Alpha galactosidase C-terminal beta sandwich domain. This domain is found at the C-terminus of alpha galactosidase enzymes.
PLN02808	PLN02808	1.69e-09	360	480	266	384	alpha-galactosidase
PLN02229	PLN02229	4.66e-08	338	482	267	420	alpha-galactosidase
COG3669	AfuC	0.004	38	216	2	191	Alpha-L-fucosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH14481.1	0.0	1	483	1	483
EFV04299.1	0.0	1	483	1	483
BBA29349.1	5.28e-304	1	481	1	482
QUB45412.1	1.76e-302	1	481	1	482
ANR72383.1	1.76e-302	1	481	1	482

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AWO_A	7.07e-77	53	480	38	466	Arthrobacterglobiformis T6 isomalto-dextranse [Arthrobacter globiformis],5AWP_A Arthrobacter globiformis T6 isomalto-dextranase complexed with isomaltose [Arthrobacter globiformis],5AWQ_A Arthrobacter globiformis T6 isomalto-dextranse complexed with panose [Arthrobacter globiformis]
4NX0_A	5.56e-13	27	482	5	443	Crystalstructure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_B Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_C Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_D Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_E Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_F Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_G Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_H Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q44052	1.01e-76	53	480	64	492	Isomalto-dextranase OS=Arthrobacter globiformis OX=1665 GN=imd PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000047	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003878_00208.