CAZyme Information: MGYG000003878_00275

Basic Information

• Species: Prevotella oris
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella oris
• CAZyme ID: MGYG000003878_00275
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
172		19685.54	10.1981

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003878	2959023	MAG	United States	North America

• Gene Location: Start: 15434; End: 15952 Strand: +

Full Sequence      

MATEAQRAFARNIYAAAKRATDIAPEFVTAQAILESGWGKSRVGNFNLFGITKGSKWTGK
TVLVLTHEYFSTPNRTFLPPERVVSVAKCKTPGRWYYTVYRLFKDFDSLSDCLAEHTRLL
QKPGYADAWPYRKNAEEFARRICNNQGSRYATSPVYQQQLLLMIRNVRSICQ

Enzyme Prediction     

No EC number prediction in MGYG000003878_00275.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	13	166	2.7e-23	0.9453125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	7.75e-23	2	165	39	180	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK12709	flgJ	3.38e-19	16	167	186	319	flagellar rod assembly protein/muramidase FlgJ; Provisional
PRK05684	flgJ	2.03e-16	15	169	165	299	flagellar assembly peptidoglycan hydrolase FlgJ.
PRK12713	flgJ	2.28e-16	16	169	194	328	flagellar rod assembly protein/muramidase FlgJ; Provisional
PRK12712	flgJ	1.45e-15	16	167	210	342	flagellar rod assembly protein/muramidase FlgJ; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB71804.1	1.49e-102	1	172	1	172
AVM53324.1	8.26e-53	9	170	6	165
BAR50235.1	2.76e-47	25	170	29	170
BAR52236.1	8.30e-47	25	170	54	195
ARB46744.1	1.51e-14	26	170	166	291

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	6.07e-11	15	164	13	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	7.09e-11	15	164	14	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	5.12e-10	15	164	14	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
3FI7_A	5.83e-08	25	164	52	174	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5DN4_A	1.80e-06	28	172	28	153	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0C2T5	5.18e-08	2	160	58	201	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
A2RHZ5	1.75e-07	2	160	58	201	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
Q9CIT4	1.76e-07	2	160	58	201	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
Q9I4P4	2.31e-07	27	169	263	387	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1
P58231	6.97e-07	17	170	163	297	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003878_00275.