CAZyme Information: MGYG000003878_00423

Basic Information

• Species: Prevotella oris
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella oris
• CAZyme ID: MGYG000003878_00423
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
784	MGYG000003878_11|CGC1	86154.61	7.19

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003878	2959023	MAG	United States	North America

• Gene Location: Start: 16270; End: 18624 Strand: +

Full Sequence      

MNIAMKKRLLTLVLLLSACSLCPTLQAKGDYPYRNAKLPTAERVADLLNRMTLEEKIGQL
RCLLAWDYYTLQQNKVYLSDTFKKDIAEGNIGMLWATFRADPWTKKSLSNGLTPYLAAQA
ANTLQKYAIEHTRLGIPLFFAEEAPHGHMAIGTTVFPTGLALAATWNTDLAETTGQCIAR
QIRLQGAHISFGPVLDLTRDPRWSRVEESMGEDPVLTACMGAAMVKGLGGGKHSQPYATI
PTLKHFVGYGTTEGGQNGCQTIGGLRDICQNFFLPFQKAIEAGATSVMTSYNSMDGMPST
ANEWLYNDVLRKRWNFTGFVISDLYSIDGLWHTHHVAHTLTEAGAMALKAGVDVDLGGRA
YQRLAEAVEKGWVKECVIDSACARILRMKFEMGLFEHPFVNVRATQDINNTVDKDVALKA
AQQLITLLKNQNNTLPLKRNIKIALVGPNADNAYNMLGDYTAPQKEGNVKTVLRGIQSKI
SMQQIKYVQGCAIRDTANSTIPESVAAARWADVVIAVVGGSSARDFKTNYQATGAAEVNA
QQVSDMESGEGYDRATLSLLGRQNELLAALKQTGKPLVVVYIEGRPLQKNWAAQHADALL
TAYYPGQEGGQAIADVLFGDINPAGRLPISVPAHVGQLPCYYNKRMPAPHDYVEMKAVPL
YAFGFGLSYTTFHYDNLRIEKRGANRFHVTFDVTNTGDRDGEEVAQLYMHDQVASVVQPI
LQLKLFARIFISKGETKQVAFDILPEDLTFIGADMNPTIEPRPIDVCIGSASDNILLKST
INTE

Enzyme Prediction     

No EC number prediction in MGYG000003878_00423.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	130	356	4.2e-67	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	44	769	38	751	beta-glucosidase BglX.
COG1472	BglX	5.99e-85	51	480	1	387	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	3.94e-83	30	745	39	744	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	4.57e-76	52	388	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	3.60e-65	425	669	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH14396.1	0.0	1	784	1	784
ADE83756.1	0.0	26	780	23	778
QVJ80985.1	0.0	26	780	23	778
ALO48411.1	0.0	27	784	29	787
QYR10513.1	0.0	19	784	11	779

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z87_A	5.88e-133	26	775	31	777	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5TF0_A	1.46e-126	35	775	2	743	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5XXL_A	5.51e-125	47	775	17	744	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
6R5I_A	2.06e-124	44	769	7	719	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
5XXN_A	3.00e-124	47	775	17	744	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	6.59e-129	44	775	38	757	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	5.87e-126	44	775	38	757	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	2.11e-115	133	772	62	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	2.14e-112	33	772	29	744	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	2.38e-91	7	780	2	773	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001530	0.588224	0.408725	0.000638	0.000504	0.000356

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003878_00423.