CAZyme Information: MGYG000003878_00863

Basic Information

• Species: Prevotella oris
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella oris
• CAZyme ID: MGYG000003878_00863
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
423	MGYG000003878_26|CGC1	48304.31	8.8459

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003878	2959023	MAG	United States	North America

• Gene Location: Start: 6126; End: 7397 Strand: +

Full Sequence      

MTTGCHAFCIIKNVSTLMRHLYALCLRGLLMLVLLASCKERKEKIVTPWGEVIGEGDSLP
KQGNFTLSDILSNGELIVLTMSGPETYYDYHGRGMGLQYLLAEKFAQKMGVSLRVEVCKD
TMEMVRRLQAGDGDLIAFPLPRRYKNVEYCGVKIDSLHAQWAVQLDNTELADSLNHWFRP
QMIAALKKEENFLLSTRSVTRHVYSPMLNRSEGIISRWDPYFRQYAPMAGWDWRLMAAQC
YQESTFDPQAHSWAGACGLMQIMPRTADHLGLSRTEIYDPERNIAAAAKYIYELSKHFSD
VSNPIERSYYVLASYNGGYFHIRDAMALARKYGRNPYSWSDVREFVLRLSTPPYYNDPVV
KYGYMRGHETVDYVSRIVDRWAQYRGFAHSAGGGFTGDSFKGFGGGLDNMAPSRAKHRNR
FKI

Enzyme Prediction     

No EC number prediction in MGYG000003878_00863.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	231	380	6.1e-26	0.7851851851851852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	8.95e-81	222	385	1	160	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK10859	PRK10859	1.69e-55	66	377	35	443	membrane-bound lytic murein transglycosylase MltF.
COG4623	MltF	3.08e-49	67	377	16	424	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
pfam01464	SLT	2.07e-23	222	337	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13401	Slt70-like	4.66e-22	218	318	6	107	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH15587.1	0.0	1	423	11	433
BCS86517.1	1.42e-212	37	423	9	390
ALO48082.1	5.50e-189	20	423	2	391
EFC70077.2	3.83e-175	29	423	9	391
AGB28026.1	1.87e-173	8	393	7	394

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OZ9_A	7.98e-26	215	377	256	414	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OWD_A	8.58e-26	215	377	263	421	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
4OYV_A	8.58e-26	215	377	263	421	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
5AA4_B	1.00e-25	215	377	249	407	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	1.00e-25	215	377	249	407	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8ZWR8	4.09e-34	66	378	33	442	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
A4WDC7	1.89e-31	67	377	36	444	Membrane-bound lytic murein transglycosylase F OS=Enterobacter sp. (strain 638) OX=399742 GN=mltF PE=3 SV=1
A6TCH2	7.52e-30	67	377	36	444	Membrane-bound lytic murein transglycosylase F OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) OX=272620 GN=mltF PE=3 SV=2
Q8XA45	1.09e-29	67	377	36	444	Membrane-bound lytic murein transglycosylase F OS=Escherichia coli O157:H7 OX=83334 GN=mltF PE=3 SV=2
Q32D14	1.49e-29	67	377	36	444	Membrane-bound lytic murein transglycosylase F OS=Shigella dysenteriae serotype 1 (strain Sd197) OX=300267 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003964	0.101920	0.893853	0.000062	0.000139	0.000067

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003878_00863.