CAZyme Information: MGYG000003878_00910

Basic Information

• Species: Prevotella oris
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella oris
• CAZyme ID: MGYG000003878_00910
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
784	MGYG000003878_27|CGC1	89048.61	8.0025

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003878	2959023	MAG	United States	North America

• Gene Location: Start: 26387; End: 28741 Strand: +

Full Sequence      

MNRKFHIKTVIATLVLSLATLTAPARGGDFTVGKNTFLLNGQPFVVKAAELHYPRIPRPY
WEQRIKMCKSLGMNTVCLYVFWNIHEQQEGKFDFTGNNDVAAFCRLAQKNGMYVIVRPGP
YVCAEWEMGGLPWWLLKKKDIRLREDDPYFMARVKAFEAEVGRQLAPLTIQNGGPIIMVQ
VENEYGSYGVNKKYVSQIRDIVKASGFDKVTLFQCDWASNFENNGLDDLVWTMNFGTGSN
IDAQFKRLKQLRPDAPLMCSEFWSGWFDKWGARHETRPAKAMVEGIDEMLSKNISFSLYM
THGGTSFGHWAGANSPGFAPDVTSYDYDAPINEYGHATPKFWELRKTMQKYNGGKRLPDV
PKPAAPIITIPKMTLTEFSPLTLGMSMPTTSHDIKSFEEMDLGWGAMFYTTKLPQIEKSS
RLSLNDAHDYAQIFIDNKLIGTIDRTKNEKSIMLPPVKKGTKLNILIEAMGRINFGRAVK
DFKGITESVIIHTEMNGHELTYNLKNWVIAPIPDSYQNAQHAFDKLNETYRCFSPINFSS
QSIGYYRGYFDLKKVGDTFLNLEQWGKGQVYVNGHALGRFWRIGPQQTLYLPGCWLKKGR
NEIIVMDIVGPKATVVWGQDQPELNKLQLEKTNKHNNQGDRPDLNSAQPVAQGELVATDL
CQTVQFDRPAKGRYIAIECQNVHGNKDYVAIAELYALNAEDYRISRDSWSVKYADSEEED
GNHTGDKAFDQQETTYWKTQEGSSFPHLLVIDLGEVRTLTGLQILSRTEKETPGAMKGYK
IYVY

Enzyme Prediction     

No EC number prediction in MGYG000003878_00910.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	37	349	7.1e-119	0.993485342019544

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	4.11e-160	36	346	1	313	Glycosyl hydrolases family 35.
PLN03059	PLN03059	5.60e-50	31	610	31	715	beta-galactosidase; Provisional
COG1874	GanA	9.68e-40	36	611	7	593	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02449	Glyco_hydro_42	1.99e-10	53	186	3	139	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
pfam00754	F5_F8_type_C	2.83e-08	716	783	5	70	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH15027.1	0.0	1	784	1	784
BCS84536.1	0.0	7	784	7	779
AGB27610.1	0.0	12	784	14	797
QVJ81893.1	0.0	7	784	4	787
ADE83089.1	0.0	7	784	4	787

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EON_A	1.03e-314	8	783	3	772	GalactanaseBT0290 [Bacteroides thetaiotaomicron VPI-5482]
3D3A_A	5.26e-265	28	624	6	589	Crystalstructure of a beta-galactosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4MAD_A	2.43e-137	35	608	22	578	ChainA, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
3WF3_A	1.52e-117	23	624	28	634	Crystalstructure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_B Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_C Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_D Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF4_A Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_B Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_C Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_D Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens]
3THC_A	1.55e-117	23	624	4	610	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48982	1.15e-122	7	591	2	573	Beta-galactosidase OS=Xanthomonas manihotis OX=43353 GN=bga PE=1 SV=1
Q95LV1	1.11e-117	14	650	14	649	Beta-galactosidase-1-like protein OS=Macaca fascicularis OX=9541 GN=GLB1L PE=2 SV=1
Q8VC60	3.44e-117	9	625	7	620	Beta-galactosidase-1-like protein OS=Mus musculus OX=10090 GN=Glb1l PE=1 SV=1
P23780	1.38e-116	34	608	39	623	Beta-galactosidase OS=Mus musculus OX=10090 GN=Glb1 PE=1 SV=1
P16278	1.60e-116	5	624	4	633	Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000272	0.999052	0.000156	0.000196	0.000158	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003878_00910.