CAZyme Information: MGYG000003878_01319

Basic Information

• Species: Prevotella oris
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella oris
• CAZyme ID: MGYG000003878_01319
• CAZy Family: GH26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
341	MGYG000003878_48|CGC1	39194.73	8.9172

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003878	2959023	MAG	United States	North America

• Gene Location: Start: 15935; End: 16960 Strand: +

Full Sequence      

MRKILFVIAIVILTTNANANRKVQQTPAQKLIERLHVLQKHGVMFGHQDALFYGTTWKWE
YGRSDVNDVCGDYPAVLGCELGGLELGNEKNLDGVPFDKMRQQIIDHYQKGGIVTISWHP
YNPVTGKDAWHTEGNAVTEVLPGGKETAKLQLWHKRLAEFFASLKDQKGNIVPVIFRPWH
EMGGAWFWWGSKQCTPTQYIALFHLTFEAMKHAGLHNLVWSYSPNAQADDTPEQYFRFYP
GDGYVDILGIDLYQYGTGKDFITQCQNEMCIMSAYAQKHHKLYALTEAGYRNTPDSKWYS
STLLPDDFRNIYKKGDFIFRSKLSDMQRKPYSVVGKKHNKK

Enzyme Prediction     

No EC number prediction in MGYG000003878_01319.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	25	296	2.7e-61	0.834983498349835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.08e-39	25	253	6	230	Glycosyl hydrolase family 26.
COG4124	ManB2	1.56e-13	172	255	180	258	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH15499.1	7.34e-248	9	341	2	367
QUB47762.1	7.26e-193	1	340	5	377
QUB41950.1	2.86e-187	1	323	1	356
QUB69107.1	2.72e-185	1	323	1	356
QUB93961.1	2.96e-177	1	341	3	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZXO_A	2.82e-84	31	305	15	288	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]
2VX5_A	2.07e-60	31	305	45	334	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
2VX4_A	2.07e-60	31	305	45	334	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
4CD4_A	3.67e-60	31	305	68	357	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX7_A	1.61e-59	31	305	45	334	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	2.29e-40	39	299	69	338	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	2.01e-35	31	289	54	318	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
P55278	3.45e-21	42	253	59	266	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis OX=1423 PE=3 SV=1
O05512	4.83e-21	66	253	79	268	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
P16699	4.54e-20	68	253	83	270	Mannan endo-1,4-beta-mannosidase A and B OS=Caldalkalibacillus mannanilyticus (strain DSM 16130 / CIP 109019 / JCM 10596 / AM-001) OX=1236954 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000314	0.999034	0.000160	0.000166	0.000149	0.000145

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003878_01319.