CAZyme Information: MGYG000003879_00702

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Duodenibacillus
• CAZyme ID: MGYG000003879_00702
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
296	MGYG000003879_33|CGC1	32505.69	10.1786

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003879	2184827	MAG	United States	North America

• Gene Location: Start: 7908; End: 8798 Strand: +

Full Sequence      

MCLPALRLLEASGFTPALVGKRWAEDLMAGMGWRFDPIEGHVTEDLSRIRYLASNAHAEK
GLLFPNSFGSALLFKIGRIKTAGLKTDGRSFLLDVKIPEPGKMHEVERFFYTAHAAIEAW
GGTPAWDKVPQKLGLLLLKRHEAAAKNLILKHRIPEKFALLAPVARGKHNGKEKNWTHFN
DLVKPLRELGVEPIVFPSQREEELARAACPDATILPPTTLGNFAAIAKRAQIVIANDSGV
SHIAAAVGTRQITLVGVTDRDRTSPWNPQAVVLGREGQWPGGDEVVSAIRKMLKSE

Enzyme Prediction     

No EC number prediction in MGYG000003879_00702.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	64	273	2e-29	0.8177777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01075	Glyco_transf_9	5.25e-31	61	274	16	228	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
COG0859	RfaF	1.23e-19	64	268	88	290	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	1.85e-19	124	274	95	241	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR02195	heptsyl_trn_II	8.57e-08	14	272	35	294	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10964	PRK10964	9.13e-07	173	259	191	283	lipopolysaccharide heptosyltransferase RfaC.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDA55160.1	2.23e-143	1	292	17	309
QQS89241.1	1.06e-135	1	295	19	315
BBF22597.1	1.24e-133	1	293	18	311
ANU65198.1	3.18e-115	1	293	17	309
QQQ96353.1	3.18e-115	1	293	17	309

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003879_00702.