CAZyme Information: MGYG000003880_00181

Basic Information

• Species: RC9 sp900543205
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900543205
• CAZyme ID: MGYG000003880_00181
• CAZy Family: CE1
• CAZyme Description: Endo-1,4-beta-xylanase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386	MGYG000003880_1|CGC2	43646.69	4.6559

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003880	2039618	MAG	United States	North America

• Gene Location: Start: 223025; End: 224185 Strand: -

Full Sequence      

MKKLILTLAAIGCGMLAATAQPDMNTRNYAFALTQPESPVFEGDSIVFKVYAPEAKNVYI
TGSWENFYVENLMKRGEDGIWTYKIAMLPPEIYQYVYDIDGMVVLDPGNYSQTRDMYNYR
SNLIIRGPESEPYFSQSSSKHGVLEKVWYDSKSYGTQRRMSVYLPYGYDAADKGKTYPVL
YLLHGGGGDEEAWPTLGRLCEIMDYMIERGLCKPMIVVTPNINSYELAACETALPDKFIF
NLQDPEMQTGDKFCNDLLYSIIPYIEQHYNTVGDKAHRGVAGLSMGGFMTMKLIHEHPEY
FNEVGVFSSGAMGGDAAASVKAIKKDGYNNFMVVCGPNDIAYRGSLELVDALKAENMDFD
FYNDLETGHVWQTWRKSLLWFAPEIF

Enzyme Prediction     

No EC number prediction in MGYG000003880_00181.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	151	378	1.5e-50	0.947136563876652

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	2.15e-26	106	379	30	289	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
cd11294	E_set_Esterase_like_N	8.74e-23	45	125	2	82	N-terminal Early set domain associated with the catalytic domain of putative esterases. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
pfam00756	Esterase	3.64e-15	151	314	1	153	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG0627	FrmB	9.47e-11	161	378	38	301	S-formylglutathione hydrolase FrmB [Defense mechanisms].
COG2819	YbbA	3.81e-10	150	309	15	170	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCO21440.1	3.14e-86	30	386	11	364
CCO21742.1	9.11e-85	30	386	8	361
CCO21493.1	9.39e-85	30	386	9	362
CCO21732.1	9.39e-85	30	386	9	362
CCO21772.1	9.39e-85	30	386	9	362

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RZN_A	4.23e-78	40	386	27	385	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
7B5V_A	8.49e-41	40	386	42	385	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6RZO_A	2.74e-37	49	386	28	343	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZO_B	2.79e-37	49	386	28	343	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6MOT_A	3.66e-32	42	386	23	358	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EY13	1.93e-36	48	386	405	725	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P31471	2.38e-31	10	386	21	388	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
D5EXZ4	8.30e-31	48	386	339	669	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P10478	8.51e-23	142	378	49	269	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
P51584	2.93e-15	158	369	841	1047	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002406	0.816464	0.180001	0.000436	0.000338	0.000313

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003880_00181.