CAZyme Information: MGYG000003880_00913

Basic Information

• Species: RC9 sp900543205
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900543205
• CAZyme ID: MGYG000003880_00913
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	MGYG000003880_4|CGC1	42756.3	8.9206

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003880	2039618	MAG	United States	North America

• Gene Location: Start: 99757; End: 100896 Strand: -

Full Sequence      

MRYYIIAGEASGDLHGSNLVRGLAAEDKEARIRFWGGDMMKEAAAESGVPAELVRHYRDG
AVMGFTEVLAKGFKLLRNVEFCREDIAAWKPDVVILIDYPGFNMKIASFCHRHGIKVFYY
IAPKTWASREGRNRRLKAWVDRLFIVFPFEKEYFSSRGIGYVYEGNPLVDAVDSHDFVRP
VPGRYIALLAGSRKAEIARTMPICMELADKLSALPRYEGYKFVVAGAPARTREDYQQYIG
SRTNVELLFGRTYDILKFADAAVVNSGTASLEAALIGTPQVVCWSTSPLTYFMAKNVLRV
GDHIKYISLGNLCIDRLAFRELIQDDFNLEEVLAEVRRLNEDEAYRSRMLADYAAIREVL
GGRGASRKVAAAMIRELKK

Enzyme Prediction     

No EC number prediction in MGYG000003880_00913.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	360	3.8e-99	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.62e-98	1	379	2	377	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.84e-97	1	379	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.20e-69	4	374	2	373	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.63e-58	5	374	10	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	9.78e-50	58	370	46	341	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASW75777.1	1.14e-109	1	366	1	357
AZA48355.1	2.29e-109	1	370	1	361
AZA63288.1	2.29e-109	1	370	1	361
ANF51148.1	1.31e-108	1	366	1	357
AYZ13923.1	1.05e-107	1	370	1	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	2.60e-36	5	334	11	339	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	2.60e-36	5	334	11	339	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q74AT9	2.98e-72	2	379	8	382	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q39T49	7.26e-70	2	379	8	382	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
B3E4H8	1.04e-65	2	370	8	373	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q1D393	1.25e-63	2	374	6	375	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	3.82e-62	5	379	8	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003880_00913.