CAZyme Information: MGYG000003881_00557

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-279
• CAZyme ID: MGYG000003881_00557
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
385		43410.37	9.4762

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003881	1968494	MAG	United States	North America

• Gene Location: Start: 86972; End: 88129 Strand: -

Full Sequence      

MKYFLIAGEASGDLHGGRLIKALREADKDSGFCYLGGDFMEKASGAKPIVHYKKMAYMAF
SEVLRHLPEIFGNMRSAKNALDSFHPDAVILIDYPSFNLKIAKYAYKKGIPVYYYISPKV
WAWKEWRVKKIKKYVRKVLSILPFETEFYARHNVESDYVGNPTYNEIYEFRQNAPEFLEF
VEKHGIRDRRPIIALLPGSRAGEIRNNLPPMYKAASRFSNFQPIVAAAPNIEKDFYACVL
NRNGIKASPLLVEADTFSLVANSAAALVTSGTATLETAVIGTPQVVCYRANGSKLAYKLF
EHILKVPFVSLPNLIANKNVVKELLLHECTPDNIAKELEPLLYDSPQWRAMCDGYNTVCE
KLGKKDSAKEAARIILHDLTPAKVR

Enzyme Prediction     

No EC number prediction in MGYG000003881_00557.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	362	7.6e-115	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	3.16e-117	1	377	2	373	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	7.51e-115	1	377	2	377	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.36e-86	4	375	2	373	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	5.37e-73	5	376	10	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	5.50e-51	1	337	2	312	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36425.1	8.14e-131	1	383	1	378
QQR08529.1	3.66e-128	1	383	1	377
ASB37800.1	3.66e-128	1	383	1	377
ANU64105.1	3.66e-128	1	383	1	377
BCI64292.1	1.22e-121	1	380	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	4.07e-39	5	376	11	378	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.10e-38	5	376	11	378	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	2.37e-69	2	384	6	383	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
C1F718	6.43e-67	4	368	8	377	Lipid-A-disaccharide synthase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) OX=240015 GN=lpxB PE=3 SV=1
Q1INL4	1.71e-65	1	376	2	375	Lipid-A-disaccharide synthase OS=Koribacter versatilis (strain Ellin345) OX=204669 GN=lpxB PE=3 SV=1
Q02AZ6	7.19e-60	2	384	3	377	Lipid-A-disaccharide synthase OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=lpxB PE=3 SV=1
Q3JAC1	6.48e-59	5	363	10	363	Lipid-A-disaccharide synthase OS=Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107) OX=323261 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003881_00557.