CAZyme Information: MGYG000003882_00582

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella
• CAZyme ID: MGYG000003882_00582
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368	MGYG000003882_39|CGC1	41140.48	6.5053

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003882	3911502	MAG	United States	North America

• Gene Location: Start: 5650; End: 6756 Strand: -

Full Sequence      

MNAVRGVLLSVLMLAAAQVSAACQWPAWEQFKKEYVSAEGRVIDPSDPRKITTSEGQSYA
LFFALAANDRQSFEMLFQWTQNNLAQGDLRAHLPGWLWGKKSDDEWTVLDTNSASDSDLW
IAWSLLEAGRLWKNDNYAEVGKALLARIAAEEVANVPGLGPLVLPGKVGFADDKGWRFNP
SYLPPQLANYFTRFGAPWPKIRDSNLRLLLETAPKGFSPDWVRYEKDSGWQLKADKPIIG
SYDAIRVYLWVGMLNNADKQKARLLARFKPMEAQTIKQGLPPEKTNIASGKTTGDGPVGF
SASLLPFLQNDDARAVQRQRVADHYPDADAYYSAVLTLFGQGWDQHRFRFAAGGELQPDW
NQECASSH

Enzyme Prediction     

EC	3.2.1.4	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	25	343	2.9e-97	0.99375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11097	PRK11097	0.0	1	368	1	376	cellulase.
COG3405	BcsZ	7.00e-146	1	350	2	350	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
pfam01270	Glyco_hydro_8	1.14e-112	22	346	1	321	Glycosyl hydrolases family 8.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QII32907.1	1.11e-263	1	368	1	368
QVJ11332.1	1.11e-263	1	368	1	368
QLS43046.1	7.51e-262	1	368	1	368
AXY28208.1	7.51e-262	1	368	1	368
QDR53955.1	7.51e-262	1	368	1	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QXQ_A	1.39e-200	22	368	1	347	Structureof the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_B Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_C Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_D Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12]
3QXF_A	3.62e-196	22	368	1	347	Structureof the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_B Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_C Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_D Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12]
7F81_A	9.42e-191	22	367	5	350	ChainA, Glucanase [Enterobacter sp. CJF-002],7F81_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F81_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F81_D Chain D, Glucanase [Enterobacter sp. CJF-002]
7F82_A	1.55e-189	22	367	5	350	ChainA, Glucanase [Enterobacter sp. CJF-002],7F82_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F82_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F82_D Chain D, Glucanase [Enterobacter sp. CJF-002]
4Q2B_A	4.91e-128	25	365	4	348	Thecrystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_B The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_C The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_D The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_E The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_F The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8X5L9	1.49e-207	1	368	1	368	Endoglucanase OS=Escherichia coli O157:H7 OX=83334 GN=bcsZ PE=3 SV=1
Q8ZLB7	2.19e-207	1	367	2	368	Endoglucanase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsZ PE=3 SV=1
Q8Z289	3.11e-207	1	367	2	368	Endoglucanase OS=Salmonella typhi OX=90370 GN=bcsZ PE=3 SV=1
P37651	4.96e-206	1	368	1	368	Endoglucanase OS=Escherichia coli (strain K12) OX=83333 GN=bcsZ PE=1 SV=1
P58935	1.99e-99	13	367	18	383	Endoglucanase OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003519	0.750348	0.245222	0.000304	0.000281	0.000304

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003882_00582.