CAZyme Information: MGYG000003883_01683

Basic Information

• Species: Kosakonia cowanii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Kosakonia; Kosakonia cowanii
• CAZyme ID: MGYG000003883_01683
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
155	MGYG000003883_68|CGC1	17297.9	10.6897

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003883	4218591	MAG	United States	North America

• Gene Location: Start: 266; End: 733 Strand: +

Full Sequence      

MIRLMLVLILLAGHSAEAHCWQRAGARYGIEPALLKAIAVVESGLSPTAVHKNRNGSTDV
GLMQINSQHFAQLRQYHITARSLITNPCQNVITGAWVLAGQIRQFGYNWEAVGAYNAGNA
RNRKTHLARLRYSQKVARIYQGLKSNDKEFAAWEK

Enzyme Prediction     

No EC number prediction in MGYG000003883_01683.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	21	147	2.2e-22	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15328	PRK15328	1.82e-51	4	154	5	153	type III secretion system invasion protein IagB.
cd13400	LT_IagB-like	4.46e-50	28	141	1	108	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
PRK13722	PRK13722	3.09e-30	1	146	5	148	lytic transglycosylase; Provisional
pfam01464	SLT	2.25e-28	21	124	1	101	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	6.98e-13	21	137	143	258	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AST68172.1	2.71e-108	1	155	1	155
APZ05513.1	5.26e-106	1	155	1	155
QAR47323.1	5.26e-106	1	155	1	155
AZI88688.1	1.24e-104	1	155	1	155
QNQ19247.1	5.44e-99	1	155	1	155

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	2.40e-11	20	103	3	87	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E1WAC2	5.01e-33	6	149	7	148	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1
P0CL15	5.01e-33	6	149	7	148	Invasion protein IagB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=iagB PE=3 SV=1
P43018	2.01e-32	6	149	7	148	Invasion protein IagB OS=Salmonella typhi OX=90370 GN=iagB PE=3 SV=1
Q07568	1.47e-30	1	149	1	147	Protein IpgF OS=Shigella flexneri OX=623 GN=ipgF PE=3 SV=1
Q55287	3.34e-29	1	149	1	147	Protein IpgF OS=Shigella sonnei OX=624 GN=ipgF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000261	0.999123	0.000155	0.000155	0.000141	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003883_01683.