CAZyme Information: MGYG000003889_00684

Basic Information

• Species: CAG-964 sp902789345
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-964; CAG-964 sp902789345
• CAZyme ID: MGYG000003889_00684
• CAZy Family: GH13
• CAZyme Description: Glycogen debranching enzyme

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
994	MGYG000003889_21|CGC1	111401.86	5.3491

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003889	1974122	MAG	United States	North America

• Gene Location: Start: 6252; End: 9236 Strand: +

Full Sequence      

MSVEILDGKKHKTLQESYETIGTYYNAKEIYPLYDGNDLGANYTPKQTVFKVWAPSANMV
SLNLYKTGSDVEQGAGKILTTQMRKNEENGVWSVAVSSDLKGVYYTYTVMVNGEARETQD
VYSFAVGVNGSRSMVVDLKSTNPVGWEDDKHILVEKPTDAVIWEIHVRDFSISRTSGVNS
EGRGKYLAFTQRGTRVNRTKNFSTCVEYLVEQGVNYVHLNPVFDFDSINEAMHTTQYNWG
YDPVNFNVPEGSYATNAAMGEVRINEFKQMVQALHDRGIGVIMDVVYNHVYSAGDSCFEK
TVPGYYFRMYSQYQYFNGSGCGNVTASDKAMFRKYMIDSVTYWANEYHIDGFRFDLMGCH
DVITMNKIREALDQIDSRILMYGEPWMADWMGNGIDGEYACTSQNSFKLDPRVGMFSDKI
RNALKGNSDDESIGYIQGATNVNNEIKSGMMGGACDTFGRWSREPIQCITYDSAHDNLTL
WDKILKSNGSNDFNGHNSILLAQNKLSAVIVLTSQGVPFYLAGEEFARTKYGDHNSYKSA
DTVNKIDWTRVIQYNNLVQYYKGLMALRSAYTPFREGNDDSIKTTYFVENGSAIGYTIQN
TTANAENEWGIAAVLVNNSASPKALDLKVNGGSVPTKWAVVVNSDRAGVERLGTISGSTI
NVPPRSALVLVDDATFDRFKAKEKHYSTVTIRHIDKDTGEVVRAVASHYIKGTTYRTYPC
KGILFDYTLVGSEGEPYGVVGDKDIEVKYFYQKDARENFILERRQITDDGTPVTAPVIKK
VKKGDKYAVKPEAVQGYELDTDRLPKSIGTINGDTTITYIDKLVPAKPLKVHYFNHNNWL
APHIYIYDDRGGSARPLSEQWPGALMNCESDNGWWSFDEVDIDEAQVMFSDGIFGQDPAA
NHPGYGVAGEVWIKNQRVYFDSKIVVSHVDVNGNKLVDDVIIEGKNKCSEDTYVAMPIKE
LGRVLNSIGEVSGMWSTTVENVVFIYETKKNSLQ

Enzyme Prediction     

No EC number prediction in MGYG000003889_00684.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	207	525	7.1e-106	0.9930795847750865

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11341	AmyAc_Pullulanase_LD-like	0.0	158	568	1	406	Alpha amylase catalytic domain found in Pullulanase (also called dextrinase; alpha-dextrin endo-1,6-alpha glucosidase), limit dextrinase, and related proteins. Pullulanase is an enzyme with action similar to that of isoamylase; it cleaves 1,6-alpha-glucosidic linkages in pullulan, amylopectin, and glycogen, and in alpha-and beta-amylase limit-dextrins of amylopectin and glycogen. Pullulanases are very similar to limit dextrinases, although they differ in their action on glycogen and the rate of hydrolysis of limit dextrins. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
TIGR02104	pulA_typeI	0.0	31	650	4	604	pullulanase, type I. Pullulan is an unusual, industrially important polysaccharide in which short alpha-1,4 chains (maltotriose) are connected in alpha-1,6 linkages. Enzymes that cleave alpha-1,6 linkages in pullulan and release maltotriose are called pullulanases although pullulan itself may not be the natural substrate. This family consists of pullulanases related to the subfamilies described in TIGR02102 and TIGR02103 but having a different domain architecture with shorter sequences. Members are called type I pullulanases.
COG1523	PulA	1.19e-133	29	670	59	689	Pullulanase/glycogen debranching enzyme [Carbohydrate transport and metabolism].
TIGR02103	pullul_strch	2.51e-112	29	671	117	895	alpha-1,6-glucosidases, pullulanase-type. Members of this protein family include secreted (or membrane-anchored) pullulanases of Gram-negative bacteria and pullulanase-type starch debranching enzymes of plants. Both enzymes hydrolyze alpha-1,6 glycosidic linkages. Pullulan is an unusual, industrially important polysaccharide in which short alpha-1,4 chains (maltotriose) are connected in alpha-1,6 linkages. Enzymes that cleave alpha-1,6 linkages in pullulan and release maltotriose are called pullulanases although pullulan itself may not be the natural substrate. This family is closely homologous to, but architecturally different from, the Gram-positive pullulanases of Gram-positive bacteria (TIGR02102). [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PLN02877	PLN02877	2.83e-102	34	549	211	798	alpha-amylase/limit dextrinase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT07019.1	1.28e-255	19	678	51	712
QCT05893.1	6.73e-209	25	819	35	826
QCT05892.1	1.40e-206	18	876	36	984
QCT07748.1	4.09e-202	13	913	20	1008
APO32485.1	1.19e-198	34	677	35	673

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LSA_A	6.22e-213	34	751	59	792	ChainA, Pullulanase [Ruminococcus bromii]
7LSR_A	9.82e-212	34	751	59	792	ChainA, Pullulanase [Ruminococcus bromii]
7LSU_A	1.05e-211	34	751	59	792	ChainA, Pullulanase [Ruminococcus bromii]
7LST_A	1.08e-211	34	751	59	792	ChainA, Pullulanase [Ruminococcus bromii]
2WAN_A	1.24e-141	34	670	313	919	Pullulanasefrom Bacillus acidopullulyticus [Bacillus acidopullulyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O33840	6.47e-129	34	670	221	840	Pullulanase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=pulA PE=1 SV=2
C0SPA0	5.84e-107	11	575	81	620	Pullulanase OS=Bacillus subtilis (strain 168) OX=224308 GN=amyX PE=1 SV=1
Q8GTR4	8.02e-65	34	549	204	791	Pullulanase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PU1 PE=1 SV=2
P07811	1.50e-59	40	556	315	926	Pullulanase OS=Klebsiella aerogenes OX=548 GN=pulA PE=1 SV=1
P07206	6.37e-58	40	556	305	916	Pullulanase OS=Klebsiella pneumoniae OX=573 GN=pulA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999987	0.000045	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003889_00684.