CAZyme Information: MGYG000003889_01654

Basic Information

• Species: CAG-964 sp902789345
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-964; CAG-964 sp902789345
• CAZyme ID: MGYG000003889_01654
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
202		22442.88	3.919

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003889	1974122	MAG	United States	North America

• Gene Location: Start: 4624; End: 5232 Strand: +

Full Sequence      

MAVIVTVVLAAALLTGVIVLFVNSNKKLGEAMHPNDYDEYVYKYAAEYSLEPNLVFAIIK
TESNFNPDAGSGAGALGLMQLMPETFEWLQNYKYGEVTMTSESLYDPEINIQYGCIFLHF
LMEKYSVEETAVAAYNAGFGAVDSWLENSEYSSDGKTLSRIPYPETEAYVEKVEWAKNYY
NSNGNNNEESTQATNSATESGD

Enzyme Prediction     

No EC number prediction in MGYG000003889_01654.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	49	174	5.5e-29	0.7777777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.24e-67	34	177	1	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	8.50e-44	34	173	3	142	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.13e-35	52	173	1	106	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16893	LT_MltC_MltE	1.76e-35	39	177	1	161	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
pfam01464	SLT	4.70e-31	43	149	3	106	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT07087.1	1.56e-52	22	180	49	206
QNK41497.1	1.26e-51	7	173	14	177
QAT49510.1	1.67e-51	9	173	13	175
CAB1248982.1	1.20e-48	19	179	30	188
CAB1246558.1	1.47e-48	9	182	26	203

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	1.13e-17	50	173	462	585	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	1.15e-17	50	173	491	614	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FCQ_A	2.84e-17	50	173	462	585	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FC4_A	2.84e-17	50	173	463	586	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
1SLY_A	3.78e-15	30	180	446	598	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	2.96e-16	24	173	45	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	9.92e-15	37	173	1422	1537	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	9.92e-15	37	173	1422	1537	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P0AGC3	7.09e-14	30	180	473	625	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	7.09e-14	30	180	473	625	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999677	0.000350	0.000002	0.000002	0.000001	0.000003

TMHMM  Annotations     

start	end
4	23