CAZyme Information: MGYG000003890_00843

Basic Information

• Species: Zag111 sp900551965
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag111; Zag111 sp900551965
• CAZyme ID: MGYG000003890_00843
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
229	MGYG000003890_5|CGC1	24665.08	10.5865

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003890	1929453	MAG	United States	North America

• Gene Location: Start: 145; End: 834 Strand: -

Full Sequence      

MKKLLLFTIALVFILCAPVQAANVSTVKAAIVKRSIEMGVDPAITLSIAKSESGFRHETR
SPRGAVGVFQLMPSTARRMGLNPYLLDDNIKGGIMYYKSMYKMFGSMELALAAYNAGPGN
VKKYRAVPPFSETKRYVARIMTDYRHLKAHPDPAMIAAKNGTNAATAAKVASTPAARPAI
AGTVKVLAQTPGKPAPLPTVSIEQARHLNVELLKEIPMEVDVKSQSVAI

Enzyme Prediction     

No EC number prediction in MGYG000003890_00843.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	40	148	7.3e-28	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.19e-38	28	145	5	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	1.49e-35	42	145	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	3.82e-34	28	147	7	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd13403	MLTF-like	9.91e-26	47	126	17	104	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16894	MltD-like	6.81e-25	52	141	17	125	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39353.1	1.16e-72	1	229	1	216
ADI02565.1	1.42e-31	37	141	102	207
ABB14930.1	3.22e-31	43	141	75	174
ATE60499.1	6.92e-31	37	151	79	195
AZT90545.1	1.91e-30	33	141	101	210

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	8.75e-13	24	149	413	557	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	8.78e-13	24	149	417	561	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	8.81e-13	24	149	423	567	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	8.83e-13	24	149	427	571	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	8.86e-13	24	149	433	577	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	2.14e-26	26	144	59	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	2.31e-24	40	144	1435	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	2.31e-24	40	144	1435	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P39434	1.50e-09	40	155	493	636	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC3	8.98e-09	40	141	493	619	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000650	0.769966	0.228615	0.000261	0.000249	0.000235

TMHMM  Annotations     

start	end
5	27