CAZyme Information: MGYG000003891_01861

Basic Information

• Species: UBA11524 sp000437595
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; UBA11524; UBA11524 sp000437595
• CAZyme ID: MGYG000003891_01861
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
885	MGYG000003891_99|CGC1	98947.97	4.7486

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003891	3063528	MAG	United States	North America

• Gene Location: Start: 3296; End: 5953 Strand: +

Full Sequence      

MMKIDLSGQWQVKLDAEKQETMPQAYPETMTLPGTTSAAGLGMPNPAKETGCLTDAYRFE
GAVWFMRTFTAGDWTGEQTMLTLERTRKTTVYLDGRPIGHQESLCTPHRYFLPPVHAGEH
TLVIRVDNTDYPTRGGHLTSPDTQSNWNGITGEISLTVAHTLLTDLTVRPDLRRGCLRVH
GHIIGAPDGVAGIVLPGQMEHLLPYRGGVLNGECPLKGDEAFWDEAHPEIHTISIDLDGD
VYETTFGLRDVRTVGRRLLINGRETFLRGKVDNLLYPKTGYTPTDVASWMTILGIAKEYG
INHYRYHTACPPDAAFTAADLLGVYMAPELPFWGTVAEEGEEGYDERERDFLFQEGFRIL
REYGHHPSFLWLSLGNELWGSKDVLNRMMRAYREADDTKLYSSGANNYQFVPDVLDEENV
FVGVRLGRERLIRGSYAMCDAPQGIVQTTAPESVSNYDASIVPETLGQSGEVGKVQIQYG
TGVKEVDAQSADALIPDVPVISHEVGQYVFYPDFSEISHYTGPLKPRNIEAMRENLERAG
MYGEHEAFFRQTGHLAVDCYKREIETLLRSREVSGFQLLDLQDYTGQGTALVGVLNAMME
NKGLISAEEWREFCAGTVVLGEFASFTGMMGEDIRFDVQISECDPEKQHTCIRCTLMDGE
RELYACDVTPGARQGRLTDAVSVTFPAECYRDAMQERITGLTIVLTLADGTRNHYPIWLI
PPIDIRITREGIEKDGRMLAFVSAEEKADGAAIVVPSAEGQLPAEYCTDFWCYPMFRSIS
ESMGKPVPVGTMGLSINTASPLLKRFAQEDYTTPVWYAILQTAHVQRLPADIHPAVQMID
NTERCARLGILYQQDGVWHLTARLWEKPNDPTVRALAWSLWEALK

Enzyme Prediction     

No EC number prediction in MGYG000003891_01861.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	413	3.8e-50	0.4853723404255319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.39e-10	1	398	10	426	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	4.89e-10	5	270	14	308	beta-D-glucuronidase; Provisional
PRK10340	ebgA	8.61e-07	6	400	44	471	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK56867.1	2.69e-253	3	853	4	890
QGH20142.1	4.97e-252	1	853	1	871
AXB87241.1	4.97e-252	1	853	1	871
QGH24177.1	4.97e-252	1	853	1	871
QJU46745.1	2.55e-249	1	880	1	902

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6D89_A	1.09e-13	57	415	95	454	Bacteroidesuniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis],6D89_B Bacteroides uniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis],6D89_C Bacteroides uniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis],6D89_D Bacteroides uniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis]
6D1N_A	1.11e-13	57	415	103	462	Apostructure of Bacteroides uniformis Beta-glucuronidase 1 [Bacteroides uniformis],6D1N_B Apo structure of Bacteroides uniformis Beta-glucuronidase 1 [Bacteroides uniformis],6D41_A Bacteriodes uniformis beta-glucuronidase 1 bound to D-glucaro-1,5-lactone [Bacteroides uniformis],6D41_B Bacteriodes uniformis beta-glucuronidase 1 bound to D-glucaro-1,5-lactone [Bacteroides uniformis],6D6W_A Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D6W_B Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D6W_C Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D6W_D Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D7F_A Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_B Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_C Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_D Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_E Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_F Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis]
7VQM_A	1.22e-11	59	415	92	451	ChainA, GH2 beta-galacturonate AqGalA [Aquimarina sp.],7VQM_B Chain B, GH2 beta-galacturonate AqGalA [Aquimarina sp.],7VQM_C Chain C, GH2 beta-galacturonate AqGalA [Aquimarina sp.],7VQM_D Chain D, GH2 beta-galacturonate AqGalA [Aquimarina sp.]
6NCW_A	4.10e-07	90	371	80	373	Crystalstructure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCW_B Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCW_C Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCW_D Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCX_A Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi],6NCX_B Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi],6NCX_C Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi],6NCX_D Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000004	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003891_01861.