CAZyme Information: MGYG000003891_02210

Basic Information

• Species: UBA11524 sp000437595
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; UBA11524; UBA11524 sp000437595
• CAZyme ID: MGYG000003891_02210
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
282	MGYG000003891_149|CGC1	31021.71	4.8305

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003891	3063528	MAG	United States	North America

• Gene Location: Start: 5611; End: 6459 Strand: -

Full Sequence      

MNPAYSQPPQRRTAPRPTQSAVPQRVESVLAETVPTETADPNRLPLWLTWTIAGLCIVLL
GLLAAHYLMQAYLTTRAEEWETARQNTLSYYHVVEGENGNSITYQPLIERYAAEYNLRPA
FVAAIIRNESSFRTDAESSVGARGLMQLMPDTAEWIAGKIGDSNYSFDHLYDAETNIRYG
CWYLNYLSKLFRGDAVLVSSAYHAGQTTVTRWLSDKGISSDGVTIPVDKLPDGPTKQYAG
RVTTSYGIYEALLYPNESAETAGAADGDSMSACAVRAGVANQ

Enzyme Prediction     

No EC number prediction in MGYG000003891_02210.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	117	247	1.4e-24	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	2.95e-71	102	248	2	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	4.00e-46	104	252	6	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
COG0741	MltE	6.59e-32	45	256	81	290	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd00254	LT-like	8.00e-31	119	247	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	2.80e-24	108	214	1	104	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTE68505.1	5.36e-65	43	254	247	451
QUC68078.1	4.05e-57	10	254	217	452
QTE71168.1	1.17e-56	50	254	256	454
QTE75132.1	1.17e-56	50	254	256	454
QUA53916.1	7.79e-55	11	254	222	460

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.74e-21	104	253	416	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	1.75e-21	104	253	420	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	1.76e-21	104	253	426	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.77e-21	104	253	430	573	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	1.78e-21	104	253	436	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	5.17e-16	80	253	456	629	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	5.17e-16	80	253	456	629	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P39434	4.19e-15	80	258	456	634	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O31608	2.14e-11	74	212	30	159	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	2.96e-11	104	212	1422	1521	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999901	0.000118	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
46	68