CAZyme Information: MGYG000003892_00560

Basic Information

• Species: Roseburia sp900753715
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia; Roseburia sp900753715
• CAZyme ID: MGYG000003892_00560
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
953	MGYG000003892_4|CGC3	108960.82	4.8976

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003892	2971162	MAG	United States	North America

• Gene Location: Start: 42578; End: 45439 Strand: +

Full Sequence      

MIKFELYKNRKTANIVIDKTNLKEKDARGIRRVAQKVCKDVERVTGVCPVIGESLCRTEN
EVVVAVLGKTPDTDGALAAELMAEMQMDVSSIRGKRESFLFVVTEQRLLIFGSDKRGTIY
GMFHISELMGVSPWVTFADVVPERKDEVYMTEADTFYSKEPSVKYRGFFINDEWPAFGNW
TFSHFGGFTAEMYDMIFETLLRLKGNYLWPAMWTSSFSLDGPGEQNAILADEYGVVMSNS
HHEPCLRHSEEWDKVRGEQSPYGNEWNYSTNREGLLNYWRDGLIRSGGYENIITIGMRGE
RDSSMLGEEASLKENIDLLKDIITEQRKLIRECVDNPDVPQMIALYKEVEAYFYGNPGKR
DGLRDWEGLDGVTFMLCEDNFGNMRTLPTEELRARKGGWGMYYHFDYHGGPISYEWVNSS
YLPKVWDQMTEAYEFGIRDIWIVNVGDLKFQEYPLSFFMDLAYDYEKWGIANRQAPQEYL
KYWCNREFKAVCDSQTLEQIAEVIQGYTRFNHNCKPEAMKPDTYHPVHDAEAERQLERIK
KIDETLEKINAVMAEEMQPAFWELLYYPAKASLNVQKLNLLAGLNHFYAAHGAAAANICA
EQMKGALALDKGFTDTFHGILGRKWDGMALSKHIGFTNWNDEECKNPVRAYVDPVEGCQI
LAYVKGDGDTVTAGGAWTGKTLIMDCFERPGQNEGIIVLLQTGNQPGNYRIHCENPGISF
SETEGAVEICKEIRVMLEREKLTGEMRFEICHENGKIPVELYCEQPRIQNVKNMTFIEDR
GIISMEASHFAEKKETAAGAFEVLFTYGKTKDGIKAYPCSRWFKEEEAPGVTYRLWVREA
GTYRLHLYCAPVNPMYPGATVCCSVSANGQKRQEISLIPQDYRAGESSCREWAQMVLEQI
RRVECEVSLQAGENTLEIFALSPGFLLEKLVLVREGKMLRTSYLGPMESFYTE

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	3	930	6e-213	0.9956958393113343

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	3.76e-179	159	517	1	333	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	5.56e-43	775	948	1	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
cd04083	CBM35_Lmo2446-like	0.005	831	918	39	108	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VCV24041.1	0.0	22	951	15	947
CBL13087.1	0.0	6	948	5	946
VCV21315.1	0.0	6	949	5	947
EEU99942.1	0.0	6	949	5	947
QAY66984.1	5.34e-283	14	951	2	964

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6NPS_A	4.15e-283	29	951	31	965	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]
4ZMH_A	5.76e-145	13	949	23	933	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
4C90_A	2.16e-113	4	641	44	652	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	4.31e-112	3	641	16	637	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	4.30e-111	3	641	15	636	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003892_00560.