CAZyme Information: MGYG000003892_01214

Basic Information

• Species: Roseburia sp900753715
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia; Roseburia sp900753715
• CAZyme ID: MGYG000003892_01214
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376		43663.66	4.7085

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003892	2971162	MAG	United States	North America

• Gene Location: Start: 6911; End: 8041 Strand: +

Full Sequence      

MDKIEKYIDELLEKSTPDRPIWNIEKILQGKKSTWNYIDGCMIKAILEMYAITKDEKYFA
FADNFIDHKVFEDGSIDGYSVEELNIDNVNAGKTLFELYDLTGKEKYRKAIDLVYSQIEQ
MPRTKEGNFWHKNIYPNQVWLDGLYMCQPFYMEYETRFNDKKNYDDIFSQFFNVVEHMRD
PKTGLYYHAYDSSREMFWCDKVTGLSQNFWLRALGWYSMALLDTLDKADASVGEPYERLK
QVFVELMDAMLKYQDESGMWYQVVNVGGMEKNYLETSGSSIMAYALLKGVRLGFLPESYR
EAGKKAFHGICEKYLSEDENGELHLDGICLVAGLGGATKRSGTFDYYMSEPVVKDDAKGV
GPFLLAYTEMRRASLI

Enzyme Prediction     

No EC number prediction in MGYG000003892_01214.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	30	371	4.8e-120	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.86e-102	32	374	31	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	1.32e-89	35	372	27	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL09353.1	2.65e-268	1	375	1	375
VCV21981.1	1.53e-267	1	375	1	375
CBL12002.1	3.10e-267	1	375	1	375
AEN96572.1	6.42e-263	1	376	1	376
SET55199.1	2.51e-221	1	376	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	8.79e-111	35	369	23	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	6.05e-68	35	370	39	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.55e-67	35	370	29	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	9.74e-13	35	319	65	337	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	3.31e-67	35	370	39	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	4.32e-43	146	369	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	4.32e-43	146	369	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003892_01214.