CAZyme Information: MGYG000003892_02382

Basic Information

• Species: Roseburia sp900753715
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia; Roseburia sp900753715
• CAZyme ID: MGYG000003892_02382
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
336	MGYG000003892_41|CGC1	37219.4	5.0561

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003892	2971162	MAG	United States	North America

• Gene Location: Start: 12168; End: 13178 Strand: -

Full Sequence      

MSTTIHVSSDSAADTPFHSINEALLSLPVDSSAPVTIALSPGIYYEKVTVRHPYVTIVGT
GTSPTDTIIRYDDYANFIMSDGKKRGTFRSYTLFVDAHDVMLRNLTVENASGDSETHGQA
IALYADGDLFTADCCRLIGHQDTLFTAPLPPKELQPDGFLGPKQTAPRTMGRHYYKNCYI
CGDVDFIFGGATAYFEDCTIESLPRKEQEQNDHNASTNASGGFIHGYVTAASTPEGEEYG
YVFSHCRLISNGCPDGSVYLGRPWREYANTVFLDCSFGPHINPALFHDWNKEAARKTIFY
AVNDSSFQERAPFVRLLTPEEADHFSREKVLGGKWD

Enzyme Prediction     

No EC number prediction in MGYG000003892_02382.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	12	331	6.6e-77	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	6.07e-69	17	305	94	374	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02682	PLN02682	4.78e-47	2	325	68	355	pectinesterase family protein
pfam01095	Pectinesterase	2.98e-46	17	333	12	297	Pectinesterase.
PLN02432	PLN02432	2.88e-45	1	334	7	289	putative pectinesterase
PLN02773	PLN02773	7.36e-44	5	325	7	290	pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL11054.1	2.19e-136	5	332	5	361
VCV23720.1	8.85e-136	5	332	5	361
CBL08524.1	8.85e-136	5	332	5	361
AEN98064.1	4.67e-127	17	333	16	326
ABX41678.1	2.41e-110	1	333	1	333

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NSP_A	9.42e-31	7	332	8	335	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
3UW0_A	8.78e-27	17	309	44	327	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
1XG2_A	1.52e-26	7	335	7	303	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	1.52e-25	7	300	11	263	Pectinmethylesterase from Carrot [Daucus carota]
1QJV_A	1.59e-25	7	332	8	335	ChainA, PECTIN METHYLESTERASE [Dickeya chrysanthemi],1QJV_B Chain B, PECTIN METHYLESTERASE [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	5.42e-36	5	336	7	301	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9FM79	1.00e-35	20	335	95	377	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q9SIJ9	1.20e-31	2	334	46	329	Putative pectinesterase 11 OS=Arabidopsis thaliana OX=3702 GN=PME11 PE=3 SV=1
Q8VYZ3	2.71e-29	4	335	86	380	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q8GXA1	6.58e-29	17	333	268	553	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003892_02382.