CAZyme Information: MGYG000003893_00421

Basic Information

• Species: Prevotella multisaccharivorax
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella multisaccharivorax
• CAZyme ID: MGYG000003893_00421
• CAZy Family: GH97
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
830	MGYG000003893_7|CGC2	94121.76	7.7698

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003893	2702422	MAG	United States	North America

• Gene Location: Start: 23163; End: 25655 Strand: -

Full Sequence      

MKKTIVIALLCYLYAMSSIAADYTLASPDGKVRGVISVAQKTEIEITYGGVSYLRIPCMA
MGTSQEVLGENVKVRNTVRHSVRRTVSPLYGINASIPESYNELQLDCKGNYSIVFRAYNE
GIAWRFVTRKGKSLIVKDEKIDYQFKDNYTAYFHPLLSESDYRIQKVSDSGQKYNYSSMP
VLVKTDDGVNILLHESGVMDYPCMSLKSDPSQPNTLTTDHARFPKVAEPGGYNNFNLVVK
RTEDYIACTSGNRAFPWRIVAFAAKDKDILNNQLVYLLAPETRLADTQWIKPGKVAWDWW
NGLNISGVDFRSGLNTATYKYYIDFAARNGIEYVNLDEGWGDQFDLLKVRDSINMQELAD
YAKSRGVGLFLWCVWHTLDRQMPQALAQFEKWGIAGLKVDFLDRDDQLVVDFEERLLKEA
AKHKLLVNFHGAYHPNGMERAYPNCINVEGVKGLEWDKIAGADGATPQTAVTIPFIRMFA
GPMDYTPGAMSNYNQAEWCIIKKRPMSQGTRCQQLAMYVVYYAPLQMLADSPTAYMKEPQ
FTKFLAGIPTVWDKTLPLDSKVGEYVNVARKKGSTWYVTGMTNWTPRDQHIRFDFLDKGR
EYVAEIVRDGINADKVGSDYVMGKRDVHAGDELNLRMMPGGGYTVRLTPKDEKHDIVVFG
DSRVQMAGDWNLRMNRTDVTNAGFGGFTTSHFIWLVDPYVIQRHPRLCFLEGGCNDIGAG
IPLERIKRNFRSLVDSLMAHGIEVVLNTVTYPTEKDPKEQNFKTEMMDSVNTFLFSLARE
KGLPCIDLNPLLTEGKRLKKEYALDNVHYTPAAYAIWVREMEKILKAKGI

Enzyme Prediction     

EC	3.2.1.22

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	14	647	3.9e-195	0.9904912836767037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	6.50e-132	286	549	1	278	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	9.75e-54	27	280	1	234	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	7.95e-40	552	648	1	97	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.
cd01828	sialate_O-acetylesterase_like2	2.86e-21	655	826	1	169	sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
pfam13472	Lipase_GDSL_2	9.91e-19	658	816	1	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB84798.1	0.0	1	830	1	830
QUB88589.1	0.0	1	830	1	830
AEA22033.1	0.0	1	830	14	843
AXV49520.1	0.0	1	830	1	830
QUI94329.1	0.0	1	830	1	830

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3A24_A	1.88e-168	27	647	6	640	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]
5E1Q_A	3.27e-167	27	647	20	654	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
5HQ4_A	5.80e-75	24	646	2	657	AGlycoside Hydrolase Family 97 enzyme from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8],5HQA_A A Glycoside Hydrolase Family 97 enzyme in complex with Acarbose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQC_A	5.80e-75	24	646	2	657	AGlycoside Hydrolase Family 97 enzyme R171K variant from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQB_A	1.54e-74	24	646	2	657	AGlycoside Hydrolase Family 97 enzyme (E480Q) in complex with Panose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A6L0	2.57e-171	3	647	2	661	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
G8JZS4	7.46e-60	1	655	1	731	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1
D7CFN7	9.24e-52	44	643	61	616	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000254	0.999052	0.000175	0.000169	0.000156	0.000150

TMHMM  Annotations     

start	end
5	27