CAZyme Information: MGYG000003893_00582

Basic Information

• Species: Prevotella multisaccharivorax
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella multisaccharivorax
• CAZyme ID: MGYG000003893_00582
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1202	MGYG000003893_10|CGC1	134441.71	6.2453

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003893	2702422	MAG	United States	North America

• Gene Location: Start: 44003; End: 47611 Strand: +

Full Sequence      

MIAALGTTLAARASEPDYRNRGIGLYPGSPAEYTAPKLTTDQTYRDIALHRTATASSSLD
YNLTAQLATDGLLSKGEPATLTVTTNKGVDNSRDRLKGIDGNCVTPYYIYGPKGWLEYLW
RGMTVHADTVRLCFEAAYDAQLPAGWRIDVEATTDGKKWMVVGHTAGTGLPGYQTRQTVS
TDPNKQTGLTNLPLRRGILSIPLSRKDMAWRGLRLRFTMPSAVWWKVCDFDEGSAGDVPA
TFDLFKAPWKQRNMSWLPAEHFYSAWVASQEAAGEPQWLRVDLGTRASVDRLRIHWLYAA
KAGEAQVSDDGSHWCTVAKLSPAKDGSIVEVACQAEARYVRLWLTQPQGRTYGIKEIEVL
GRGGVVAQPANTLDMGKGKLSLNSWQIRRSLPSGTAQLQGASPWIEATVPGTALTSYINV
GAAPETTVANNMRQVSESFFNADFIYRTTIHVHKGEISNGEGCLASALPHKYLCFDGIDW
RTVVELNGQRLGRIDGAFTRARFDISKVLKEGDNELVVHVMKNAHPGPVKIKNQESTDLN
GGVLGADNPTFHPTIGWDWITSTPGRCMGIWNDVWITADNGVSLCDPLVTTELDLPDTLA
TVTPTVKVVSTREAPLQLRLSGWIGPIRFSREITVGAGETREVSFSPAEYSQLARQRLRL
WWPNGYGEPWLYDAGFALTSKTDTIATIHYKTGIRQMGSALVPSPDGDGERLQLFINGQR
VDPLGGNWGFPETNLRYRGREYDATVRYHREMNMNMIRNWVGQTGDDEFYDACDKYGIMV
WQDFWLANPWDGPDPDDEKMFMQNARDLISRIRRHPSIALYCGRNEGYPPATLQHALKVS
IAELHPQLTYIGSSADDVVSGHGPYGMKPTAWYFSNISAKFHSEEGMPNIPTWESLHRFM
NPDRLWPQGDAWGEHDFCMEGAPKGKDFNAIMERHFGEPASAKQFTKWAQWLNYDGHRAM
FESWQTNRQGLIMWMSHPCWPSMVWQTYDYYLEPTAAYFAIKKACEPLHIQWNPAKREVE
VVNISRDLGKPLKAEMQLFDTEGRVISTQEAQTQPQRDTTVVVFSDVAIPDKDVYFLRLR
LIDDNTIVSDNFYVEGREADKLQALTTVIAKAQLAVSQRFVHEENQWKGTVTVKNDGNCP
ALFIRLNLMGSDGEQILPAIYSDNYFALMPGESKSVSISFSDADSRGTEPRVVVSAFEHG
VE

Enzyme Prediction     

No EC number prediction in MGYG000003893_00582.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	377	1132	2.6e-78	0.7593085106382979

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.77e-39	430	1172	52	795	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam18368	Ig_GlcNase	1.50e-27	1091	1197	1	102	Exo-beta-D-glucosaminidase Ig-fold domain. This domain can be found in 2 glycoside hydrolase subfamily of beta-glucosaminidases (EC:3.2.1.165) such as CsxA, from Amycolatopsis orientalis that has exo-beta-D-glucosaminidase (exo-chitosanase) activity. It has an immunoglobulin-like topology.
PRK10340	ebgA	3.38e-09	475	826	132	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00754	F5_F8_type_C	4.70e-08	264	350	24	118	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam02836	Glyco_hydro_2_C	1.10e-06	766	891	61	204	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALO48125.1	0.0	5	1197	13	1173
QRO23425.1	0.0	1	1197	20	1195
QKH99266.1	0.0	17	1197	43	1204
AST55694.1	0.0	17	1197	43	1204
QRO15146.1	0.0	17	1197	43	1204

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VZO_A	2.89e-53	402	1202	79	894	Crystalstructure of Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis],2VZO_B Crystal structure of Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis]
2VZS_A	6.74e-53	402	1202	79	894	ChitosanProduct complex of Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis],2VZS_B Chitosan Product complex of Amycolatopsis orientalis exo-chitosanase CsxA [Amycolatopsis orientalis],2X05_A Inhibition of the exo-beta-D-glucosaminidase CsxA by a glucosamine- configured castanospermine and an amino-australine analogue [Amycolatopsis orientalis],2X05_B Inhibition of the exo-beta-D-glucosaminidase CsxA by a glucosamine- configured castanospermine and an amino-australine analogue [Amycolatopsis orientalis],2X09_A Inhibition of the exo-beta-D-glucosaminidase CsxA by a glucosamine- configured castanospermine and an amino-australine analogue [Amycolatopsis orientalis],2X09_B Inhibition of the exo-beta-D-glucosaminidase CsxA by a glucosamine- configured castanospermine and an amino-australine analogue [Amycolatopsis orientalis]
2VZT_A	3.65e-52	402	1202	79	894	Complexof Amycolatopsis orientalis exo-chitosanase CsxA E541A with PNP-beta-D-glucosamine [Amycolatopsis orientalis],2VZT_B Complex of Amycolatopsis orientalis exo-chitosanase CsxA E541A with PNP-beta-D-glucosamine [Amycolatopsis orientalis],2VZV_A Substrate Complex of Amycolatopsis orientalis exo-chitosanase CsxA E541A with chitosan [Amycolatopsis orientalis],2VZV_B Substrate Complex of Amycolatopsis orientalis exo-chitosanase CsxA E541A with chitosan [Amycolatopsis orientalis]
2VZU_A	1.49e-51	402	1202	79	894	Complexof Amycolatopsis orientalis exo-chitosanase CsxA D469A with PNP-beta-D-glucosamine [Amycolatopsis orientalis],2VZU_B Complex of Amycolatopsis orientalis exo-chitosanase CsxA D469A with PNP-beta-D-glucosamine [Amycolatopsis orientalis]
2VJX_A	5.21e-44	400	1179	21	817	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82NR8	5.91e-78	401	1197	79	894	Exo-beta-D-glucosaminidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=csxA PE=1 SV=1
Q75W54	7.26e-71	379	1199	20	936	Mannosylglycoprotein endo-beta-mannosidase OS=Arabidopsis thaliana OX=3702 GN=EBM PE=1 SV=3
Q5H7P5	3.92e-69	392	1192	31	938	Mannosylglycoprotein endo-beta-mannosidase OS=Lilium longiflorum OX=4690 GN=EBM PE=1 SV=4
Q56F26	3.69e-52	402	1202	79	894	Exo-beta-D-glucosaminidase OS=Amycolatopsis orientalis OX=31958 GN=csxA PE=1 SV=2
C0LRA7	3.35e-48	355	1183	4	871	Exo-beta-D-glucosaminidase OS=Hypocrea virens OX=29875 GN=gls1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.261171	0.737128	0.000392	0.000580	0.000373	0.000330

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003893_00582.