CAZyme Information: MGYG000003893_00617

Basic Information

• Species: Prevotella multisaccharivorax
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella multisaccharivorax
• CAZyme ID: MGYG000003893_00617
• CAZy Family: GH32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
530	MGYG000003893_11|CGC1	59335.63	4.7985

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003893	2702422	MAG	United States	North America

• Gene Location: Start: 41353; End: 42945 Strand: +

Full Sequence      

MIFSSIAVALAALSLTACSDDNFGPDADKDWAGTTSFFNSTDEKGFDTYYQPAVGRCGDP
MPFYDEKTGDFKVLYLQEYDNNGTYNYHPIWGVSTKDGANYESMGEVLPTATSDKEQDAA
LGTGCAVYDEQSGTYYIYYTGHNPKCESTEVVMRATSPDMKTWTKDNAWSLKGTDYGYSK
TDFRDPQVFKTEDGTWHMVIASALKFAEFTSTDLKTWQHAGSFSMVWDRQLECPDIFKMG
NYWYFVYSEGYRSDWSRKVKYFVASSFEELKKCFNDPGANWPKDGHESVLDSRAFYAGKT
ASNGTDRYIWGWCPYRTGSTIFEKNINVGADGEPNWSGALVCHKLIQHSDGTLTLGEVPA
ISAKYDKLQDLKAMEQSEGATVNGSTVSLSGNSHVLFNRLGNHNKISFTVKTAGNTDKFG
FSLVRAGGEGDSKHYSIVINPENDQTRKINFEEQGKDGMGFVRGIDGYNFARPADNTYHV
TVYTDNSVCVVYINDVACYTNRIYGIQKNCWSLDCYDGQVTVSEVKVMQY

Enzyme Prediction     

No EC number prediction in MGYG000003893_00617.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	50	342	4.6e-39	0.9351535836177475

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08995	GH32_EcAec43-like	1.67e-99	58	353	1	281	Glycosyl hydrolase family 32, such as the putative glycoside hydrolase Escherichia coli Aec43 (FosGH2). This glycosyl hydrolase family 32 (GH32) subgroup includes Escherichia coli strain BEN2908 putative glycoside hydrolase Aec43 (FosGH2). GH32 enzymes cleave sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). GH32 family also contains other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize.
pfam16346	DUF4975	2.06e-83	351	527	1	176	Domain of unknown function (DUF4975). This family consists of uncharacterized proteins around 500 residues in length and is mainly found in various Bacteroides species. Several proteins in this family are annotated as Glycosyl hydrolases, but the function of this protein is unknown.
cd08996	GH32_FFase	1.28e-27	79	314	22	256	Glycosyl hydrolase family 32, beta-fructosidases. Glycosyl hydrolase family GH32 cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). This family also contains other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
smart00640	Glyco_32	1.81e-22	50	495	2	436	Glycosyl hydrolases family 32.
pfam00251	Glyco_hydro_32N	1.75e-20	85	312	26	269	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84703.1	6.29e-269	8	530	10	531
ADE83520.1	2.35e-257	1	529	4	531
QVJ79967.1	1.16e-253	1	529	4	534
ANR72116.1	1.86e-220	1	530	4	531
QUB45691.1	1.86e-220	1	530	4	531

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6R3R_A	1.73e-179	29	530	11	502	Firstcrystal structure of endo-levanase BT1760 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron]
6R3U_A	1.40e-178	29	530	11	502	Endo-levanaseBT1760 mutant E221A from Bacteroides thetaiotaomicron complexed with levantetraose [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000039	0.036093	0.963851	0.000013	0.000018	0.000014

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003893_00617.