CAZyme Information: MGYG000003897_00165

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas
• CAZyme ID: MGYG000003897_00165
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
332	MGYG000003897_4|CGC1	37869.35	5.285

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003897	1257213	MAG	United States	North America

• Gene Location: Start: 19337; End: 20335 Strand: -

Full Sequence      

MNCSRWNEIRRDPTRMRRLLRSITLSLWGAVLVGVVYYFVVVYKAPQPQTARTHTTSQAE
WHDVPIADVGAGEDYEELEQYGTLYALEYLLDYDSIWPNDEVSLLKLFGLYEEEEDDEDD
EEEVVQVKVVPAKPTSTPEASAKQSTRHRGVISDWDHLFQQYGNKYGWDWYVLAAIAYQE
SKFRAEVVGMGGATGLMGIMPATGRRYGYSRAKLKHAESSIRVACMALRDFGRAFAHITD
AEQRMKFTLASYNSGSAHVLDARRLAEDAGLDPDRWDDSVEIYMSRLNEPKYYNDPLVQH
GRANGAHTVRYVAEVFSRAQSYKSKVQYATAE

Enzyme Prediction     

No EC number prediction in MGYG000003897_00165.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	167	328	8.4e-21	0.8666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	7.86e-66	159	323	1	160	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG4623	MltF	1.99e-28	149	315	265	424	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
PRK10859	PRK10859	5.88e-26	154	313	289	441	membrane-bound lytic murein transglycosylase MltF.
cd16896	LT_Slt70-like	1.63e-12	160	274	9	121	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	1.72e-12	159	266	1	106	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE12384.1	1.06e-190	1	332	1	331
BAK25352.1	7.50e-52	136	325	283	471
AUR47574.1	7.50e-52	136	325	283	471
AKV63991.1	5.64e-51	149	325	293	471
ALO29436.1	5.64e-51	149	325	293	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OZ9_A	2.27e-14	159	315	263	414	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OYV_A	2.32e-14	159	315	270	421	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
4OWD_A	2.32e-14	159	315	270	421	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5AA4_B	3.25e-14	159	315	256	407	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	3.25e-14	159	315	256	407	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0AQY9	5.38e-18	158	315	292	444	Membrane-bound lytic murein transglycosylase F OS=Maricaulis maris (strain MCS10) OX=394221 GN=mltF PE=3 SV=2
A8ZWR8	9.74e-18	158	325	289	451	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
A1U3J1	2.07e-17	158	315	289	441	Membrane-bound lytic murein transglycosylase F OS=Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8) OX=351348 GN=mltF PE=3 SV=1
Q085S2	6.35e-17	151	315	277	434	Membrane-bound lytic murein transglycosylase F OS=Shewanella frigidimarina (strain NCIMB 400) OX=318167 GN=mltF PE=3 SV=1
Q8EC56	1.56e-16	169	315	291	432	Membrane-bound lytic murein transglycosylase F OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	42