CAZyme Information: MGYG000003899_01434

Basic Information

• Species: Faecalibacterium sp900539945
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium sp900539945
• CAZyme ID: MGYG000003899_01434
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
263		30472.13	8.9414

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003899	2460696	MAG	China	Asia

• Gene Location: Start: 21346; End: 22137 Strand: -

Full Sequence      

MRRKTAAVCRATDEVLCVSIPKIIHYCWFGGGPISEADRKCMESWKKYCPDYKIIEWNEQ
NFEISANRYAQQAYEAKKYAFVSDYARLAVVYEYGGIYLDTDVELVRPLDELLELPGFMG
FQNNNEVATGLGFGACKGNPVVQALLRDYDALDFIKADGSVDLTPCPERNTKVLQTLGVR
KDGTRQSIAEMEIFPAEYFCPMDFYSRKLRVTPKTYSIHRYAESWKPKPSAVSRILQRLL
KKRYYTWYCPLRGRIEGRLRKRI

Enzyme Prediction     

No EC number prediction in MGYG000003899_01434.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	39	113	2.1e-26	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	1.27e-21	20	147	82	212	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	2.03e-20	35	113	1	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	1.20e-10	20	149	46	191	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	0.001	58	102	153	193	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZY91881.1	3.62e-83	20	225	2	207
QBS00042.1	1.23e-82	20	225	2	207
CAD0163186.1	1.46e-82	20	225	2	207
CAD0163987.1	1.46e-82	20	225	2	207
AAP32730.1	2.07e-82	20	225	2	207

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q10323	1.02e-09	19	154	56	193	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
Q9UNA3	2.89e-06	83	230	150	280	Alpha-1,4-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=A4GNT PE=1 SV=1
Q14BT6	6.99e-06	83	230	151	281	Alpha-1,4-N-acetylglucosaminyltransferase OS=Mus musculus OX=10090 GN=A4gnt PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003899_01434.