CAZyme Information: MGYG000003899_01438

Basic Information

• Species: Faecalibacterium sp900539945
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium sp900539945
• CAZyme ID: MGYG000003899_01438
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315		33738.91	5.2132

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003899	2460696	MAG	China	Asia

• Gene Location: Start: 24823; End: 25770 Strand: -

Full Sequence      

MLCITVAQDGSGDFASISEAVLAVPYDCPAQIRIGAGIYREKLVCEKKDITLQGAGADCT
RLVWGDGGKLPHPDGRPTHTFRSYTAFFSGERLRVEDLTIENDAGPGAKAGQAVAAYVDS
AHAVFEKVRLLGNQDTLFCAPLPEKEREKDGFLGPRGLAPRRASAQYYHDCEIAGDIDFI
FGGADALFEQCVLRTVNNGLPHSWVTAPSGSAEGLGFVFWDCDFVSDSCPQGTVYLGRPW
RPTGKTAVLASRLGAHIAPEGFAGWNDRTDSDLARFAEAGNTGAGACPRGPWVQALDETQ
AGALLCAARRRCRPE

Enzyme Prediction     

No EC number prediction in MGYG000003899_01438.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	4	302	1.6e-74	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	2.15e-50	4	286	2	266	Pectinesterase.
COG4677	PemB	6.91e-50	6	286	87	377	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02773	PLN02773	5.28e-44	4	305	7	291	pectinesterase
PLN02682	PLN02682	5.15e-42	4	301	71	352	pectinesterase family protein
PLN02745	PLN02745	5.40e-38	4	286	287	551	Putative pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB27671.1	5.24e-198	1	315	1	314
CBL01447.1	5.24e-198	1	315	1	314
AXA81880.1	1.43e-180	1	315	1	314
CBK98674.1	4.10e-180	1	315	1	314
QIA44050.1	5.22e-180	1	314	1	313

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	2.04e-28	4	290	9	277	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	3.79e-28	6	286	7	269	ChainA, Pectinesterase 1 [Solanum lycopersicum]
3UW0_A	1.50e-21	6	286	35	335	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	3.41e-19	7	286	12	311	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
5C1C_A	8.98e-18	3	286	10	266	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	2.91e-38	4	302	7	288	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8VYZ3	6.54e-32	8	305	90	370	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q8GXA1	2.74e-31	6	286	260	523	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q43062	2.45e-30	6	286	211	474	Pectinesterase/pectinesterase inhibitor PPE8B OS=Prunus persica OX=3760 PE=2 SV=1
O49006	1.17e-28	5	286	283	546	Pectinesterase/pectinesterase inhibitor 3 OS=Arabidopsis thaliana OX=3702 GN=PME3 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003899_01438.