CAZyme Information: MGYG000003902_01929

Basic Information

• Species: Veillonella dispar
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Veillonellaceae; Veillonella; Veillonella dispar
• CAZyme ID: MGYG000003902_01929
• CAZy Family: GT9
• CAZyme Description: ADP-heptose--LPS heptosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
390	MGYG000003902_25|CGC1	44086.17	7.7037

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003902	2119735	MAG	China	Asia

• Gene Location: Start: 8654; End: 9826 Strand: +

Full Sequence      

MNILFVRLSYIGDILHATPAARWIKEHYPEAKLHWIVTPSMVELLQGNPYVDEIIPWERD
EYEAHSKKLHIPTMWRMWWELRDKLKPYKFDVAVDVQGRLITGLVLLASGAPIRLGLGGT
KELNWMFTNYKAKPSTEHVIKRYIEVAKLLNTAVVEHSGLTTSTTVIADDEKPCIVNGSN
GKRLYHMDFFVPSDLHAWAENQWESINYDTSLNRGEVDKPLRIGLVLGTSWATKEWPQEK
WYSLIKSLQYRANFVCLGGPKEATQYKPLMDSITADGLDKIMLNMLGKTTLQEVGALIES
CDVVVTADTGALHIALALNKPVVALFGPTDPKLWGPLTGNFKVLVNDELDCLGCRKRRCP
KPDQYCMSGIESVRVKKAIFELIGDKHGKV

Enzyme Prediction     

No EC number prediction in MGYG000003902_01929.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	79	363	1.6e-54	0.9688888888888889

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	2.70e-63	2	379	1	275	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	4.63e-53	1	387	2	334	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	1.76e-37	78	360	1	242	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
TIGR02195	heptsyl_trn_II	1.47e-28	2	384	1	334	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10422	PRK10422	2.26e-16	3	342	8	304	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBU35857.1	1.44e-277	1	390	1	390
VEG92969.1	1.14e-274	1	390	1	390
BBU33942.1	3.26e-274	1	390	1	390
CAB1274687.1	1.88e-255	1	390	1	391
SNU95034.1	2.97e-252	1	390	1	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	6.69e-17	8	383	16	345	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]
2GT1_A	2.00e-15	1	335	1	288	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	2.00e-15	1	335	1	288	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	2.15e-15	1	335	1	288	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]
1PSW_A	2.78e-13	2	344	2	305	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q57336	2.36e-17	2	336	10	291	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1
P25742	9.52e-15	8	340	1	290	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
P24173	1.02e-14	1	335	1	288	Lipopolysaccharide heptosyltransferase 1 OS=Escherichia coli (strain K12) OX=83333 GN=rfaC PE=1 SV=1
P37692	1.33e-14	1	344	1	305	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1
P45042	1.76e-14	1	356	1	317	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003902_01929.